« Back
Home /
Recombinant Mouse Cystatin-C (Cst3)

Recombinant Mouse Cystatin-C (Cst3)

Item no.	BM-RPC25764-100ug
Manufacturer	Biomatik
Amount	100ug
Category	Neuroscience Molecular Targets for Neuroscience Aging & Neurological Disorders Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Mouse
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Cystatin-3
Similar products	Cystatin-3
Available
Gene Name	Cst3
Alternative Names	Cystatin-3
Uniprot	P21460
Source	E.coli
Expression Region	21-140aa
AA Sequence	ATPKQGPRMLGAPEEADANEEGVRRALDFAVSEYN KGSNDAYHSRAIQVVRARKQLVAGVNYFLDVEMGR TTCTKSQTNLTDCPFHDQPHLMRKALCSFQIYSVP WKGTHSLTKFSCKNA
Sequence Info	Full Length of Mature Protein
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Theoretical MW	20.4 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	As an inhibitor of cysteine proteinases, this protein is thought to serve an important physiological role as a local regulator of this enzyme activity.
Function	As an inhibitor of cysteine proteinases, this protein is thought to serve an important physiological role as a local regulator of this enzyme activity.
Subcellular location	Secreted
Protein Families	Cystatin family

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Delivery expected until 11/1/2024

Express Delivery: Save 30 days

Compare

Add to wishlist

Recommend by mail