« Back
Home /
Recombinant Vaccinia virus Protein L1 (VACWR088), partial

Recombinant Vaccinia virus Protein L1 (VACWR088), partial

Item no.	BM-RPC25715-1mg
Manufacturer	Biomatik
Amount	1mg
Category	Neuroscience Neural Adhesion Molecules Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Virion membrane protein M25
Similar products	Virion membrane protein M25
Available
Gene Name	VACWR088
Alternative Names	Virion membrane protein M25
Uniprot	P07612
Source	E.coli
Expression Region	2-183aa
AA Sequence	GAAASIQTTVNTLSERISSKLEQEANASAQTKCDI EIGNFYIRQNHGCNLTVKNMCSADADAQLDAVLSA ATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVR DFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAPG SPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAP KQVAGTG
Sequence Info	Partial
Tag Info	N-terminal 6xHis-tagged
Theoretical MW	24.8 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Envelope protein which probably plays a role in virus entry into the host cell. Is probably involved in the virus attachment to the host cell surface and associates with the entry/fusion complex (EFC). Needed for fusion and penetration of the virus core into host cell.
Function	Envelope protein which probably plays a role in virus entry into the host cell. Is probably involved in the virus attachment to the host cell surface and associates with the entry/fusion complex (EFC). Needed for fusion and penetration of the virus core into host cell.
Subcellular location	Virion membrane, Single-pass membrane protein
Protein Families	Chordopoxvirinae L1 family

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Delivery expected until 4/24/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Recommend by mail