« Back
Home /
Recombinant Pig Rhodopsin (RHO), partial

Recombinant Pig Rhodopsin (RHO), partial

Item no.	BM-RPC25714-1mg
Manufacturer	Biomatik
Amount	1mg
Category	Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Porcine
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	RHO1
Similar products	RHO1
Available
Gene Name	RHO
Alternative Names	RHO1
Uniprot	O18766
Source	E.coli
Expression Region	1-36aa
AA Sequence	MNGTEGPNFYVPFSNKTGVVRSPFEYPQYYLAEPW
Sequence Info	Partial
Tag Info	N-terminal GST-tagged
Theoretical MW	31.2 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling via G-proteins. Subsequent receptor phosphorylation mediates displacement of the bound G-protein alpha subunit by the arrestin SAG and terminates signaling
Function	Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth
Subcellular location	Membrane, Multi-pass membrane protein, Cell projection, cilium, photoreceptor outer segment
Protein Families	G-protein coupled receptor 1 family, Opsin subfamily

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Delivery expected until 4/24/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Recommend by mail