Item no. |
BM-RPC25687-1mg |
Manufacturer |
Biomatik
|
Amount |
1mg |
Category |
|
Type |
Proteins Recombinant |
Specific against |
Human (Homo sapiens) |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Dnm1p/Vps1p-like protein (DVLP) (Dynamin family member proline-rich carboxyl-terminal domain less ) (Dymple) (Dynamin-like protein) (Dynamin-like protein 4) (Dynamin-like protein IV) (HdynIV) (Dynamin-related protein 1) (DLP1) (DRP1) |
Similar products |
Dnm1p/Vps1p-like protein (DVLP) (Dynamin family member proline-rich carboxyl-terminal domain less ) (Dymple) (Dynamin-like protein) (Dynamin-like protein 4) (Dynamin-like protein IV) (HdynIV) (Dynamin-related protein 1) (DLP1) (DRP1) |
Available |
|
Gene Name |
DNM1L |
Alternative Names |
Dnm1p/Vps1p-like protein (DVLP) (Dynamin family member proline-rich carboxyl-terminal domain less ) (Dymple) (Dynamin-like protein) (Dynamin-like protein 4) (Dynamin-like protein IV) (HdynIV) (Dynamin-related protein 1) (DLP1) (DRP1) |
Uniprot |
O00429 |
Source |
E.coli |
Expression Region |
1-710aa |
AA Sequence |
MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQS SGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHV SQEDKRKTTGEENGVEAEEWGKFLHTKNKLYTDFD EIRQEIENETERISGNNKGVSPEPIHLKIFSPNVV NLTLVDLPGMTKVPVGDQPKDIELQIRELILRFIS NPNSIILAVTAANTDMATSEALKISREVDPDGRRT LAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVV NRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRN GTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQY QSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEG TAKYIETSELCGGARICYIFHETFGRTLESVDPLG GLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQ IKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELL RFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIE LAYINTKHPDFADACGLMNNNIEEQRRNRLARELP SAVSRDKLIQDSRRETKNVASGGGGVGDGVQEPTT GNWRGMLKTSKAEELLAEEKSKPIPIMPASPQKGH AVNLLDVPVPVARKLSAREQRDCEVIERLIKSYFL IVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLY KSSLLDDLLTESEDMAQRRKEAADMLKALQGASQI IAEIRETHLW |
Sequence Info |
Full Length of Isoform 2 |
Tag Info |
N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Theoretical MW |
84.4 kDa |
Purity |
>85% as determined by SDS-PAGE. |
Storage Buffer |
Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Endotoxin Level |
Not tested |
Biological Activity |
Not tested |
Shipping Condition |
Ice packs |
Storage |
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles. |
Expiry Date |
1 year |
Restriction |
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals. |
Relevance |
Functions in mitochondrial and peroxisomal division. Mediates membrane fission through oligomerization into membrane-associated tubular structures that wrap around the scission site to constrict and sever the mitochondrial membrane through a GTP hydrolysis-dependent mechanism. Through its function in mitochondrial division, ensures the survival of at least some types of postmitotic neurons, including Purkinje cells, by suppressing oxidative damage. Required for normal brain development, including that of cerebellum. Facilitates developmentally regulated apoptosis during neural tube formation. Required for a normal rate of cytochrome c release and caspase activation during apoptosis; this requirement may depend upon the cell type and the physiological apoptotic cues. Plays an important role in mitochondrial fission during mitosis. Required for formation of endocytic vesicles. Proposed to regulate synaptic vesicle membrane dynamics through association with BCL2L1 isoform Bcl-X(L) which stimulates its GTPase activity in synaptic vesicles; the function may require its recruitment by MFF to clathrin-containing vesicles. Required for programmed necrosis execution. |
Function |
Functions in mitochondrial and peroxisomal division. Mediates membrane fission through oligomerization into membrane-associated tubular structures that wrap around the scission site to constrict and sever the mitochondrial membrane through a GTP hydrolysis-dependent mechanism. Through its function in mitochondrial division, ensures the survival of at least some types of postmitotic neurons, including Purkinje cells, by suppressing oxidative damage. Required for normal brain development, including that of cerebellum. Facilitates developmentally regulated apoptosis during neural tube formation. Required for a normal rate of cytochrome c release and caspase activation during apoptosis; this requirement may depend upon the cell type and the physiological apoptotic cues. Plays an important role in mitochondrial fission during mitosis |
Involvement in disease |
Encephalopathy due to defective mitochondrial and peroxisomal fission 1 (EMPF1) |
Subcellular location |
Cytoplasm, cytosol, Golgi apparatus, Endomembrane system, Peripheral membrane protein, Mitochondrion outer membrane, Peripheral membrane protein, Peroxisome, Membrane, clathrin-coated pit, Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane |
Protein Families |
TRAFAC class dynamin-like GTPase superfamily, Dynamin/Fzo/YdjA family |
Tissue Specificity |
Ubiquitously expressed with highest levels found in skeletal muscles, heart, kidney and brain. Isoform 1 is brain-specific. Isoform 2 and isoform 3 are predominantly expressed in testis and skeletal muscles respectively. Isoform 4 is weakly expressed in brain, heart and kidney. Isoform 5 is dominantly expressed in liver, heart and kidney. Isoform 6 is expressed in neurons. |
Paythway |
TNFsignalingpathway |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.