« Back
Home /
Recombinant Escherichia coli ATP-dependent Clp protease proteolytic subunit (clpP)

Recombinant Escherichia coli ATP-dependent Clp protease proteolytic subunit (clpP)

Item no.	BM-RPC25679-1mg
Manufacturer	Biomatik
Amount	1mg
Category	Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Endopeptidase Clp
Similar products	Endopeptidase Clp
Available
Gene Name	clpP
Alternative Names	Endopeptidase Clp
Uniprot	Q1RF98
Source	E.coli
Expression Region	15-207aa
AA Sequence	ALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQV EDHMANLIVAQMLFLEAENPEKDIYLYINSPGGVI TAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLTA GAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAR EILKVKGRMNELMALHTGQSLEQIERDTERDRFLS APEAVEYGLVDSILTHRN
Sequence Info	Full Length of Mature Protein
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Theoretical MW	28.6 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.
Function	Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.
Subcellular location	Cytoplasm
Protein Families	Peptidase S14 family

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Delivery expected until 4/24/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Recommend by mail