« Back
Home /
Recombinant Human Ficolin-3 (FCN3)

Recombinant Human Ficolin-3 (FCN3)

Item no.	BM-RPC25666-1mg
Manufacturer	Biomatik
Amount	1mg
Category	Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins Cell Biology Cell Movement Cell Adhesion Cell Stainings ECM
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Collagen/fibrinogen domain-containing lectin 3 p35 Collagen/fibrinogen domain-containing protein 3 Hakata antigen FCNH, HAKA1
Similar products	HAKA1, Collagen/fibrinogen domain-containing lectin 3 p35 Collagen/fibrinogen domain-containing protein 3 Hakata antigen FCNH
Available
Gene Name	FCN3
Alternative Names	Collagen/fibrinogen domain-containing lectin 3 p35 Collagen/fibrinogen domain-containing protein 3 Hakata antigen FCNH, HAKA1
Uniprot	O75636
Source	E.coli
Expression Region	24-299aa
AA Sequence	QEHPSCPGPRELEASKVVLLPSCPGAPGSPGEKGA PGPQGPPGPPGKMGPKGEPGDPVNLLRCQEGPRNC RELLSQGATLSGWYHLCLPEGRALPVFCDMDTEGG GWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEFWL GNENLHQLTLQGNWELRVELEDFNGNRTFAHYATF RLLGEVDHYQLALGKFSEGTAGDSLSLHSGRPFTT YDADHDSSNSNCAVIVHGAWWYASCYRSNLNGRYA VSEAAAHKYGIDWASGRGVGHPYRRVRMMLR
Sequence Info	Full Length of Mature Protein
Tag Info	C-terminal 6xHis-tagged
Theoretical MW	34.8 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	May function in innate immunity through activation of the lectin complement pathway. Calcium-dependent and GlcNAc-binding lectin. Has affinity with GalNAc, GlcNAc, D-fucose, as mono/oligosaccharide and lipopolysaccharides from S.typhimurium and S.minnesota.
Function	May function in innate immunity through activation of the lectin complement pathway. Calcium-dependent and GlcNAc-binding lectin. Has affinity with GalNAc, GlcNAc, D-fucose, as mono/oligosaccharide and lipopolysaccharides from S.typhimurium and S.minnesota.
Involvement in disease	Ficolin 3 deficiency (FCN3D)
Subcellular location	Secreted
Protein Families	Ficolin lectin family
Tissue Specificity	Liver and lung. In liver it is produced by bile duct epithelial cells and hepatocytes. In lung it is produced by both ciliated bronchial epithelial cells and type II alveolar epithelial cells.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Delivery expected until 4/24/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Recommend by mail