Item no. |
BM-RPC25659-1mg |
Manufacturer |
Biomatik
|
Amount |
1mg |
Category |
|
Type |
Proteins Recombinant |
Specific against |
Human (Homo sapiens) |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
GST class-piGSTP1-1 |
Similar products |
GST class-piGSTP1-1 |
Available |
|
Gene Name |
GSTP1 |
Alternative Names |
GST class-piGSTP1-1 |
Uniprot |
P09211 |
Source |
Yeast |
Expression Region |
2-210aa |
AA Sequence |
PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTV ETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILR HLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYIS LIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGK TFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPL LSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ |
Sequence Info |
Full Length of Mature Protein |
Tag Info |
N-terminal 10xHis-tagged |
Theoretical MW |
25.7 kDa |
Purity |
>90% as determined by SDS-PAGE. |
Storage Buffer |
Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Endotoxin Level |
Not tested |
Biological Activity |
Not tested |
Shipping Condition |
Ice packs |
Storage |
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles. |
Expiry Date |
1 year |
Restriction |
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals. |
Relevance |
Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Regulates negatively CDK5 activity via p25/p35 translocation to prevent neurodegeneration. |
Function |
Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Regulates negatively CDK5 activity via p25/p35 translocation to prevent neurodegeneration. |
Subcellular location |
Cytoplasm, Mitochondrion, Nucleus |
Protein Families |
GST superfamily, Pi family |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.