« Back
Home /
Recombinant Macaca fascicularis Legumain (LGMN)

Recombinant Macaca fascicularis Legumain (LGMN)

Item no.	BM-RPC25657-1mg
Manufacturer	Biomatik
Amount	1mg
Category	Neuroscience Aging & Neurological Disorders Peptides & Proteins Recombinant Proteins Cardiovascular Research Heart Failure Myocardial Infarction
Type	Proteins Recombinant
Specific against	Monkey
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Asparaginyl endopeptidase Protease, cysteine 1 Gene namesi Name:LGMN PRSC1
Similar products	Asparaginyl endopeptidase Protease, cysteine 1 Gene namesi Name:LGMN PRSC1
Available
Gene Name	LGMN
Alternative Names	Asparaginyl endopeptidase Protease, cysteine 1 Gene namesi Name:LGMN PRSC1
Uniprot	Q4R4T8
Source	E.coli
Expression Region	18-323aa
AA Sequence	VPIDDPEDGGKHWVVIVAGSNGWYNYRHQADACHA YQIIHRNGIPDEQIVVMMYDDIAYSEDNPTPGIVI NRPNGTDVYQGVPKDYTGEDVTPQNFLAVLRGDAE AVKGIGSGKVLKSGPQDHVFVYFTDHGSTGILVFP NEDLHVKDLNETIYYMYKHKMYRKMVFYIEACESG SMMNHLPDNINVYATTAANPRESSYACYYDEKRST YLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHT NTSHVMQYGNKTISTMKVMQFQGMKHKASSPLSLP PVTHLDLTPSPDVPLTIMKRKLMNTN
Sequence Info	Full Length of Mature Protein
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Theoretical MW	39.7 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Has a strict specificity for hydrolysis of asparaginyl bonds. Can also cleave aspartyl bonds slowly, especially under acidic conditions. Required for normal lysosomal protein degradation in renal proximal tubules. Required for normal degradation of internalized EGFR. Plays a role in the regulation of cell proliferation via its role in EGFR degradation. May be involved in the processing of proteins for MHC class II antigen presentation in the lysosomal/endosomal system
Function	Has a strict specificity for hydrolysis of asparaginyl bonds. Can also cleave aspartyl bonds slowly, especially under acidic conditions. Required for normal lysosomal protein degradation in renal proximal tubules. Required for normal degradation of internalized EGFR. Plays a role in the regulation of cell proliferation via its role in EGFR degradation. May be involved in the processing of proteins for MHC class II antigen presentation in the lysosomal/endosomal system (By similarity).
Subcellular location	Lysosome
Protein Families	Peptidase C13 family

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Delivery expected until 12/27/2024

Express Delivery: Save 7 days

Compare

Add to wishlist

Recommend by mail