« Back
Home /
Recombinant Human Glutathione S-transferase P (GSTP1)

Recombinant Human Glutathione S-transferase P (GSTP1)

Item no.	BM-RPC25643-1mg
Manufacturer	Biomatik
Amount	1mg
Category	Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	GST class-piGSTP1-1
Similar products	GST class-piGSTP1-1
Available
Gene Name	GSTP1
Alternative Names	GST class-piGSTP1-1
Uniprot	P09211
Source	E.coli
Expression Region	2-210aa
AA Sequence	PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTV ETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILR HLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYIS LIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGK TFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPL LSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Sequence Info	Full Length of Mature Protein
Tag Info	N-terminal 10xHis-tagged
Theoretical MW	28.2 kDa
Purity	>90% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Regulates negatively CDK5 activity via p25/p35 translocation to prevent neurodegeneration.
Function	Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Regulates negatively CDK5 activity via p25/p35 translocation to prevent neurodegeneration.
Subcellular location	Cytoplasm, Mitochondrion, Nucleus
Protein Families	GST superfamily, Pi family

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Delivery expected until 4/24/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Recommend by mail