« Back
Home /
Recombinant Mouse Sclerostin domain-containing protein 1 (Sostdc1)

Recombinant Mouse Sclerostin domain-containing protein 1 (Sostdc1)

Item no.	BM-RPC25641-100ug
Manufacturer	Biomatik
Amount	100ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Mouse (Murine, Mus musculus)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Ectodermal BMP inhibitor Short name: Ectodin Sclerostin-like protein Uterine sensitization-associated gene 1 protein Short name: USAG-1 Sostl, Usag1
Similar products	Ectodermal BMP inhibitor Short name: Ectodin Sclerostin-like protein Uterine sensitization-associated gene 1 protein Short name: USAG-1 Sostl, Usag1
Available
Gene Name	Sostdc1
Alternative Names	Ectodermal BMP inhibitor Short name: Ectodin Sclerostin-like protein Uterine sensitization-associated gene 1 protein Short name: USAG-1 Sostl, Usag1
Uniprot	Q9CQN4
Source	E.coli
Expression Region	24-206aa
AA Sequence	FKNDATEILYSHVVKPVPAHPSSNSTLNQARNGGR HFSSTGLDRNSRVQVGCRELRSTKYISDGQCTSIS PLKELVCAGECLPLPVLPNWIGGGYGTKYWSRRSS QEWRCVNDKTRTQRIQLQCQDGSTRTYKITVVTAC KCKRYTRQHNESSHNFESVSPAKPAQHHRERKRAS KSSKHSLS
Sequence Info	Full Length of Mature Protein
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Theoretical MW	27.6 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	May be involved in the onset of endometrial receptivity for implantation/sensitization for the decidual cell reaction. Enhances Wnt signaling and inhibits TGF-beta signaling. Directly antagonizes activity of BMP2, BMP4, BMP6 and BMP7 in a dose-dependent manner.
Function	May be involved in the onset of endometrial receptivity for implantation/sensitization for the decidual cell reaction. Enhances Wnt signaling and inhibits TGF-beta signaling (By similarity). Directly antagonizes activity of BMP2, BMP4, BMP6 and BMP7 in a dose-dependent manner.
Subcellular location	Secreted
Protein Families	Sclerostin family
Tissue Specificity	Highly expressed in kidney at renal collecting ducts level and weakly in brain.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Delivery expected until 2/28/2025

Express Delivery: Save 8 days

Compare

Add to wishlist

Recommend by mail