« Back
Home /
Recombinant Mouse Perforin-1 (Prf1)

Recombinant Mouse Perforin-1 (Prf1)

Item no.	BM-RPC25638-1mg
Manufacturer	Biomatik
Amount	1mg
Category	Neuroscience Aging & Neurological Disorders Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Mouse
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Cytolysin Lymphocyte pore-forming protein Short name: PFP
Similar products	Cytolysin Lymphocyte pore-forming protein Short name: PFP
Available
Gene Name	Prf1
Alternative Names	Cytolysin Lymphocyte pore-forming protein Short name: PFP
Uniprot	P10820
Source	E.coli
Expression Region	21-554aa
AA Sequence	PCYTATRSECKQKHKFVPGVWMAGEGMDVTTLRRS GSFPVNTQRFLRPDRTCTLCKNSLMRDATQRLPVA ITHWRPHSSHCQRNVAAAKVHSTEGVAREAAANIN NDWRVGLDVNPRPEANMRASVAGSHSKVANFAAEK TYQDQYNFNSDTVECRMYSFRLVQKPPLHLDFKKA LRALPRNFNSSTEHAYHRLISSYGTHFITAVDLGG RISVLTALRTCQLTLNGLTADEVGDCLNVEAQVSI GAQASVSSEYKACEEKKKQHKMATSFHQTYRERHV EVLGGPLDSTHDLLFGNQATPEQFSTWTASLPSNP GLVDYSLEPLHTLLEEQNPKREALRQAISHYIMSR ARWQNCSRPCRSGQHKSSHDSCQCECQDSKVTNQD CCPRQRGLAHLVVSNFRAEHLWGDYTTATDAYLKV FFGGQEFRTGVVWNNNNPRWTDKMDFENVLLSTGG PLRVQVWDADYGWDDDLLGSCDRSPHSGFHEVTCE LNHGRVKFSYHAKCLPHLTGGTCLEYAPQGLLGDP PGNRSGAVW
Sequence Info	Full Length of Mature Protein
Tag Info	N-terminal 6xHis-tagged
Theoretical MW	63.9 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Plays a key role in secretory granule-dependent cell death, and in defense against virus-infected or neoplastic cells. Plays an important role in killing other cells that are recognized as non-self by the immune system, e.g. in transplant rejection or some forms of autoimmune disease. Can insert into the membrane of target cells in its calcium-bound form, oligomerize and form large pores. Promotes cytolysis and apoptosis of target cells by facilitating the uptake of cytotoxic granzymes.
Function	Plays a key role in secretory granule-dependent cell death, and in defense against virus-infected or neoplastic cells. Can insert into the membrane of target cells in its calcium-bound form, oligomerize and form large pores. Promotes cytolysis and apoptosis of target cells by facilitating the uptake of cytotoxic granzymes.
Subcellular location	Cytoplasmic granule lumen, Secreted, Cell membrane, Multi-pass membrane protein, Endosome lumen
Protein Families	Complement C6/C7/C8/C9 family
Tissue Specificity	Detected in cytotoxic T-lymphocytes and natural killer cells.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Delivery expected until 12/27/2024

Express Delivery: Save 8 days

Compare

Add to wishlist

Recommend by mail