Item no. |
BM-RPC25613-100ug |
Manufacturer |
Biomatik
|
Amount |
100ug |
Category |
|
Type |
Proteins Recombinant |
Specific against |
Mouse |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
1-O-acylceramide synthase1 Short name: ACS LCAT-like lysophospholipase Short name: LLPL Lysophospholipase 3 Lysosomal phospholipase A22 Short name: LPLA2 |
Similar products |
1-O-acylceramide synthase1 Short name: ACS LCAT-like lysophospholipase Short name: LLPL Lysophospholipase 3 Lysosomal phospholipase A22 Short name: LPLA2 |
Available |
|
Gene Name |
Pla2g15 |
Alternative Names |
1-O-acylceramide synthase1 Short name: ACS LCAT-like lysophospholipase Short name: LLPL Lysophospholipase 3 Lysosomal phospholipase A22 Short name: LPLA2 |
Uniprot |
Q8VEB4 |
Source |
E.coli |
Expression Region |
34-412aa |
AA Sequence |
AQRHPPVVLVPGDLGNQLEAKLDKPKVVHYLCSKK TDSYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSR ATQFPDGVDVRVPGFGETFSMEFLDPSKRNVGSYF YTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPY FLALREMIEEMYQMYGGPVVLVAHSMGNVYMLYFL QRQPQVWKDKYIHAFVSLGAPWGGVAKTLRVLASG DNNRIPVIGPLKIREQQRSAVSTSWLLPYNHTWSH EKVFVYTPTTNYTLRDYHRFFRDIGFEDGWFMRQD TEGLVEAMTPPGVELHCLYGTGVPTPNSFYYESFP DRDPKICFGDGDGTVNLESVLQCQAWQSRQEHRVS LQELPGSEHIEMLANATTLAYLKRVLLEP |
Sequence Info |
Full Length of Mature Protein |
Tag Info |
N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Theoretical MW |
50.5 kDa |
Purity |
>85% as determined by SDS-PAGE. |
Storage Buffer |
Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Endotoxin Level |
Not tested |
Biological Activity |
Not tested |
Shipping Condition |
Ice packs |
Storage |
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles. |
Expiry Date |
1 year |
Restriction |
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals. |
Relevance |
Has transacylase and calcium-independent phospholipase A2 activity. Catalyzes the formation of 1-O-acyl-N-acetylsphingosine and the concomitant release of a lyso-phospholipid. Has high activity with 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine (POPC) and 1, 2-dioleoyl-sn-glycero-3-phosphocholine (DOPC), catalyzing the transfer of oleic acid to N-acetyl-sphingosine. Required for normal phospholipid degradation in alveolar and peritoneal macrophages and in spleen |
Function |
Has transacylase and calcium-independent phospholipase A2 activity. Catalyzes the formation of 1-O-acyl-N-acetylsphingosine and the concomitant release of a lyso-phospholipid |
Subcellular location |
Secreted, Lysosome, Membrane, Peripheral membrane protein |
Protein Families |
AB hydrolase superfamily, Lipase family |
Tissue Specificity |
Detected in blood plasma (PubMed:20410020). Detected in alveolar macrophages (at protein level) (PubMed:16106046, PubMed:16880524, PubMed:19017977). Detected in heart, liver, spleen, kidney, thymus, brain and lung (PubMed:16880524). |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.