« Back
Home /
Recombinant chicken Interleukin-8 (CXCL8), partial

Recombinant chicken Interleukin-8 (CXCL8), partial

Item no.	BM-RPC25601-1mg
Manufacturer	Biomatik
Amount	1mg
Category	Oncology Neuroscience Neuroinflammation Metabolism Diabetes By Cell Type Carcinoma Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Gallus
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	9E3 C-X-C motif chemokine 8 CEF-4 Chemokine (C-X-C motif) ligand 8 Embryo fibroblast protein 1
Similar products	9E3 C-X-C motif chemokine 8 CEF-4 Chemokine (C-X-C motif) ligand 8 Embryo fibroblast protein 1
Available
Gene Name	CXCL8
Alternative Names	9E3 C-X-C motif chemokine 8 CEF-4 Chemokine (C-X-C motif) ligand 8 Embryo fibroblast protein 1
Uniprot	P08317
Source	E.coli
Expression Region	17-102aa
AA Sequence	ALSQGRTLVKMGNELRCQCISTHSKFIHPKSIQDV KLTPSGPHCKNVEIIATLKDGREVCLDPTAPWVQL IVKALMAKAQLNSDAP
Sequence Info	Partial
Tag Info	Tag-Free
Theoretical MW	9.4 kDa
Purity	>90% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	May be an autocrine factor that promotes the growth of fibroblasts and is involved in the neoplastic transformation of fibroblasts by v-Src. Chemotactic for peripheral blood mononuclear cells as well as for heterophils.
Function	May be an autocrine factor that promotes the growth of fibroblasts and is involved in the neoplastic transformation of fibroblasts by v-Src. Chemotactic for peripheral blood mononuclear cells as well as for heterophils.
Subcellular location	Secreted
Protein Families	Intercrine alpha (chemokine CxC) family

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Delivery expected until 4/24/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Recommend by mail