Comparison

Recombinant Human Epithelial cell adhesion molecule (EPCAM), partial

Item no. BM-RPC25600-1mg
Manufacturer Biomatik
Amount 1mg
Category
Type Proteins Recombinant
Specific against Human
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Adenocarcinoma-associated antigen Cell surface glycoprotein Trop-1 Epithelial cell surface antigen Epithelial glycoprotein Short name: EGP Epithelial glycoprotein 314 Short name: EGP314 Short name: hEGP314 KS 1/4 antigen KSA Major gastrointestinal tumor-a
Similar products Adenocarcinoma-associated antigen Cell surface glycoprotein Trop-1 Epithelial cell surface antigen Epithelial glycoprotein Short name: EGP Epithelial glycoprotein 314 Short name: EGP314 Short name: hEGP314 KS 1/4 antigen KSA Major gastrointestinal tumor-a
Available
Gene Name
EPCAM
Alternative Names
Adenocarcinoma-associated antigen Cell surface glycoprotein Trop-1 Epithelial cell surface antigen Epithelial glycoprotein Short name: EGP Epithelial glycoprotein 314 Short name: EGP314 Short name: hEGP314 KS 1/4 antigen KSA Major gastrointestinal tumor-associated protein GA733-2 Tumor-associated calcium signal transducer 1 CD_antigen: CD326
Uniprot
P16422
Source
E.coli
Expression Region
24-265aa
AA Sequence
QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVI CSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDG LYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTD KDTEITCSERVRTYWIIIELKHKAREKPYDSKSLR TALQKEITTRYQLDPKFITSILYENNVITIDLVQN SSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDL TVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK
Sequence Info
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Theoretical MW
43.4 kDa
Purity
>90% as determined by SDS-PAGE.
Storage Buffer
Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level
Not tested
Biological Activity
Not tested
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
May act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. Plays a role in embryonic stem cells proliferation and differentiation. Up-regulates the expression of FABP5, MYC and cyclins A and E.
Function
May act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. Plays a role in embryonic stem cells proliferation and differentiation. Up-regulates the expression of FABP5, MYC and cyclins A and E.
Involvement in disease
Diarrhea 5, with tufting enteropathy, congenital (DIAR5); Hereditary non-polyposis colorectal cancer 8 (HNPCC8)
Subcellular location
Lateral cell membrane, Single-pass type I membrane protein, Cell junction, tight junction
Protein Families
EPCAM family
Tissue Specificity
Highly and selectively expressed by undifferentiated rather than differentiated embryonic stem cells (ESC). Levels rapidly diminish as soon as ESC's differentiate (at protein levels). Expressed in almost all epithelial cell membranes but not on mesodermal or neural cell membranes. Found on the surface of adenocarcinoma.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close