Item no. |
BM-RPC23882-50ug |
Manufacturer |
Biomatik
|
Amount |
50ug |
Category |
|
Type |
Proteins Recombinant |
Specific against |
Human |
ECLASS 5.1 |
34160400 |
ECLASS 6.1 |
34160400 |
ECLASS 8.0 |
42020190 |
ECLASS 9.0 |
42020190 |
ECLASS 10.0.1 |
32160409 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
GP1,2 Short name: GP |
Similar products |
GP1, 2 Short name: GP |
Available |
|
Gene Name |
GP |
Alternative Names |
GP1, 2 Short name: GP |
Uniprot |
Q7T9D9 |
Source |
Mammalian cell |
Expression Region |
502-637aa |
AA Sequence |
QTNTKATGKCNPNLHYWTAQEQHNAAGIAWIPYFG PGAEGIYTEGLMHNQNALVCGLRQLANETTQALQL FLRATTELRTYTILNRKAIDFLLRRWGGTCRILGP DCCIEPHDWTKNITDKINQIIHDFIDNPLPN |
Sequence Info |
Partial |
Tag Info |
N-terminal 6xHis-tagged |
Theoretical MW |
19.4 kDa |
Purity |
>90% as determined by SDS-PAGE. |
Storage Buffer |
Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Endotoxin Level |
Not tested |
Biological Activity |
Not tested |
Shipping Condition |
Ice packs |
Storage |
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles. |
Expiry Date |
1 year |
Restriction |
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals. |
Relevance |
GP1 is responsible for binding to the receptor(s) on target cells. Interacts with CD209/DC-SIGN and CLEC4M/DC-SIGNR which act as cofactors for virus entry into the host cell. Binding to CD209 and CLEC4M, which are respectively found on dendritic cells (DCs), and on endothelial cells of liver sinusoids and lymph node sinuses, facilitate infection of macrophages and endothelial cells. These interactions not only facilitate virus cell entry, but also allow capture of viral particles by DCs and subsequent transmission to susceptible cells without DCs infection (trans infection). Binding to the macrophage specific lectin CLEC10A also seems to enhance virus infectivity. |
Function |
GP1 is responsible for binding to the receptor(s) on target cells. Interacts with CD209/DC-SIGN and CLEC4M/DC-SIGNR which act as cofactors for virus entry into the host cell. Binding to CD209 and CLEC4M, which are respectively found on dendritic cells (DCs), and on endothelial cells of liver sinusoids and lymph node sinuses, facilitate infection of macrophages and endothelial cells. These interactions not only facilitate virus cell entry, but also allow capture of viral particles by DCs and subsequent transmission to susceptible cells without DCs infection (trans infection). Binding to the macrophage specific lectin CLEC10A also seem to enhance virus infectivity. Interaction with FOLR1/folate receptor alpha may be a cofactor for virus entry in some cell types, although results are contradictory. Members of the Tyro3 receptor tyrosine kinase family also seem to be cell entry factors in filovirus infection. Once attached, the virions are internalized through clathrin-dependent endocytosis and/or macropinocytosis. After internalization of the virus into the endosomes of the host cell, proteolysis of GP1 by two cysteine proteases, CTSB/cathepsin B and CTSL/cathepsin L presumably induces a conformational change of GP2, allowing its binding to the host entry receptor NPC1 and unmasking its fusion peptide to initiate membranes fusion. |
Subcellular location |
GP2: Virion membrane, Single-pass type I membrane protein, Host cell membrane, Single-pass type I membrane protein, Note=In the cell, localizes to the plasma membrane lipid rafts, which probably represent the assembly and budding site, SUBCELLULAR LOCATION: GP1: Virion membrane, Peripheral membrane protein, Host cell membrane, Peripheral membrane protein, Note=GP1 is not anchored to the viral envelope, but forms a disulfid-linked complex with the extravirion surface GP2, In the cell, both GP1 and GP2 localize to the plasma membrane lipid rafts, which probably represent the assembly and budding site, GP1 can also be shed after proteolytic processing, SUBCELLULAR LOCATION: GP2-delta: Secreted |
Protein Families |
Filoviruses glycoprotein family |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.