Comparison

Recombinant Sudan ebolavirus Envelope glycoprotein (GP), partial

Item no. BM-RPC23882-50ug
Manufacturer Biomatik
Amount 50ug
Category
Type Proteins Recombinant
Specific against Human
ECLASS 5.1 34160400
ECLASS 6.1 34160400
ECLASS 8.0 42020190
ECLASS 9.0 42020190
ECLASS 10.0.1 32160409
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias GP1,2 Short name: GP
Similar products GP1, 2 Short name: GP
Available
Gene Name
GP
Alternative Names
GP1, 2 Short name: GP
Uniprot
Q7T9D9
Source
Mammalian cell
Expression Region
502-637aa
AA Sequence
QTNTKATGKCNPNLHYWTAQEQHNAAGIAWIPYFG PGAEGIYTEGLMHNQNALVCGLRQLANETTQALQL FLRATTELRTYTILNRKAIDFLLRRWGGTCRILGP DCCIEPHDWTKNITDKINQIIHDFIDNPLPN
Sequence Info
Partial
Tag Info
N-terminal 6xHis-tagged
Theoretical MW
19.4 kDa
Purity
>90% as determined by SDS-PAGE.
Storage Buffer
Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level
Not tested
Biological Activity
Not tested
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
GP1 is responsible for binding to the receptor(s) on target cells. Interacts with CD209/DC-SIGN and CLEC4M/DC-SIGNR which act as cofactors for virus entry into the host cell. Binding to CD209 and CLEC4M, which are respectively found on dendritic cells (DCs), and on endothelial cells of liver sinusoids and lymph node sinuses, facilitate infection of macrophages and endothelial cells. These interactions not only facilitate virus cell entry, but also allow capture of viral particles by DCs and subsequent transmission to susceptible cells without DCs infection (trans infection). Binding to the macrophage specific lectin CLEC10A also seems to enhance virus infectivity.
Function
GP1 is responsible for binding to the receptor(s) on target cells. Interacts with CD209/DC-SIGN and CLEC4M/DC-SIGNR which act as cofactors for virus entry into the host cell. Binding to CD209 and CLEC4M, which are respectively found on dendritic cells (DCs), and on endothelial cells of liver sinusoids and lymph node sinuses, facilitate infection of macrophages and endothelial cells. These interactions not only facilitate virus cell entry, but also allow capture of viral particles by DCs and subsequent transmission to susceptible cells without DCs infection (trans infection). Binding to the macrophage specific lectin CLEC10A also seem to enhance virus infectivity. Interaction with FOLR1/folate receptor alpha may be a cofactor for virus entry in some cell types, although results are contradictory. Members of the Tyro3 receptor tyrosine kinase family also seem to be cell entry factors in filovirus infection. Once attached, the virions are internalized through clathrin-dependent endocytosis and/or macropinocytosis. After internalization of the virus into the endosomes of the host cell, proteolysis of GP1 by two cysteine proteases, CTSB/cathepsin B and CTSL/cathepsin L presumably induces a conformational change of GP2, allowing its binding to the host entry receptor NPC1 and unmasking its fusion peptide to initiate membranes fusion.
Subcellular location
GP2: Virion membrane, Single-pass type I membrane protein, Host cell membrane, Single-pass type I membrane protein, Note=In the cell, localizes to the plasma membrane lipid rafts, which probably represent the assembly and budding site, SUBCELLULAR LOCATION: GP1: Virion membrane, Peripheral membrane protein, Host cell membrane, Peripheral membrane protein, Note=GP1 is not anchored to the viral envelope, but forms a disulfid-linked complex with the extravirion surface GP2, In the cell, both GP1 and GP2 localize to the plasma membrane lipid rafts, which probably represent the assembly and budding site, GP1 can also be shed after proteolytic processing, SUBCELLULAR LOCATION: GP2-delta: Secreted
Protein Families
Filoviruses glycoprotein family

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close