Comparison

Recombinant Human Insulin-like growth factor 1 receptor (IGF1R), partial

Item no. BM-RPC23828-50ug
Manufacturer Biomatik
Amount 50ug
Category
Type Proteins Recombinant
Specific against Human
ECLASS 5.1 34160400
ECLASS 6.1 34160400
ECLASS 8.0 42020190
ECLASS 9.0 42020190
ECLASS 10.0.1 32160409
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Insulin-like growth factor I receptor Short name: IGF-I receptor
Similar products Insulin-like growth factor I receptor Short name: IGF-I receptor
Available
Gene Name
IGF1R
Alternative Names
Insulin-like growth factor I receptor Short name: IGF-I receptor
Uniprot
P08069
Source
Mammalian cell
Expression Region
763-931aa
AA Sequence
YNITDPEELETEYPFFESRVDNKERTVISNLRPFT LYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGAD DIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEI KYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGNYT ARIQATSLSGNGSWTDPVFFYVQAKTGYE
Sequence Info
Partial
Tag Info
N-terminal 10xHis-tagged
Theoretical MW
21.9 kDa
Purity
>85% as determined by SDS-PAGE.
Storage Buffer
Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level
Not tested
Biological Activity
Not tested
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Receptor tyrosine kinase which mediates actions of insulin-like growth factor 1 (IGF1). Binds IGF1 with high affinity and IGF2 and insulin (INS) with a lower affinity. The activated IGF1R is involved in cell growth and survival control. IGF1R is crucial for tumor transformation and survival of malignant cell. Ligand binding activates the receptor kinase, leading to receptor autophosphorylation, and tyrosines phosphorylation of multiple substrates, that function as signaling adapter proteins including, the insulin-receptor substrates (IRS1/2), Shc and 14-3-3 proteins. Phosphorylation of IRSs proteins lead to the activation of two main signaling pathways: the PI3K-AKT/PKB pathway and the Ras-MAPK pathway. The result of activating the MAPK pathway is increased cellular proliferation, whereas activating the PI3K pathway inhibits apoptosis and stimulates protein synthesis. Phosphorylated IRS1 can activate the 85 kDa regulatory subunit of PI3K (PIK3R1), leading to activation of several downstream substrates, including protein AKT/PKB. AKT phosphorylation, in turn, enhances protein synthesis through mTOR activation and triggers the antiapoptotic effects of IGFIR through phosphorylation and inactivation of BAD. In parallel to PI3K-driven signaling, recruitment of Grb2/SOS by phosphorylated IRS1 or Shc leads to recruitment of Ras and activation of the ras-MAPK pathway. In addition to these two main signaling pathways IGF1R signals also through the Janus kinase/signal transducer and activator of transcription pathway (JAK/STAT). Phosphorylation of JAK proteins can lead to phosphorylation/activation of signal transducers and activators of transcription (STAT) proteins. In particular activation of STAT3, may be essential for the transforming activity of IGF1R. The JAK/STAT pathway activates gene transcription and may be responsible for the transforming activity. JNK kinases can also be activated by the IGF1R. IGF1 exerts inhibiting activities on JNK activation via phosphorylation and inhibition of MAP3K5/ASK1, which is able to directly associate with the IGF1R. When present in a hybrid receptor with INSR, binds IGF1. PubMed:12138094 shows that hybrid receptors composed of IGF1R and INSR isoform Long are activated with a high affinity by IGF1, with low affinity by IGF2 and not significantly activated by insulin, and that hybrid receptors composed of IGF1R and INSR isoform Short are activated by IGF1, IGF2 and insulin. In contrast, PubMed:16831875 shows that hybrid receptors composed of IGF1R and INSR isoform Long and hybrid receptors composed of IGF1R and INSR isoform Short have similar binding characteristics, both bind IGF1 and have a low affinity for insulin.
Function
Receptor tyrosine kinase which mediates actions of insulin-like growth factor 1 (IGF1). Binds IGF1 with high affinity and IGF2 and insulin (INS) with a lower affinity. The activated IGF1R is involved in cell growth and survival control. IGF1R is crucial for tumor transformation and survival of malignant cell. Ligand binding activates the receptor kinase, leading to receptor autophosphorylation, and tyrosines phosphorylation of multiple substrates, that function as signaling adapter proteins including, the insulin-receptor substrates (IRS1/2), Shc and 14-3-3 proteins. Phosphorylation of IRSs proteins lead to the activation of two main signaling pathways
Involvement in disease
Insulin-like growth factor 1 resistance (IGF1RES)
Subcellular location
Cell membrane, Single-pass type I membrane protein
Protein Families
Protein kinase superfamily, Tyr protein kinase family, Insulin receptor subfamily
Tissue Specificity
Found as a hybrid receptor with INSR in muscle, heart, kidney, adipose tissue, skeletal muscle, hepatoma, fibroblasts, spleen and placenta (at protein level). Expressed in a variety of tissues. Overexpressed in tumors, including melanomas, cancers of the colon, pancreas prostate and kidney.
Paythway
HIF-1signalingpathway

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close