Item no. |
BM-RPC23821-50ug |
Manufacturer |
Biomatik
|
Amount |
50ug |
Category |
|
Type |
Proteins Recombinant |
Specific against |
Rat |
ECLASS 5.1 |
34160400 |
ECLASS 6.1 |
34160400 |
ECLASS 8.0 |
42020190 |
ECLASS 9.0 |
42020190 |
ECLASS 10.0.1 |
32160409 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Fatty acid-binding protein 3 Heart-type fatty acid-binding protein Short name: H-FABP |
Similar products |
Fatty acid-binding protein 3 Heart-type fatty acid-binding protein Short name: H-FABP |
Available |
|
Gene Name |
FABP3 |
Alternative Names |
Fatty acid-binding protein 3 Heart-type fatty acid-binding protein Short name: H-FABP |
Uniprot |
P07483 |
Source |
Mammalian cell |
Expression Region |
2-133aa |
AA Sequence |
ADAFVGTWKLVDSKNFDDYMKSLGVGFATRQVASM TKPTTIIEKNGDTITIKTHSTFKNTEISFQLGVEF DEVTADDRKVKSVVTLDGGKLVHVQKWDGQETTLT RELSDGKLILTLTHGNVVSTRTYEKEA |
Sequence Info |
Full Length of Mature Protein |
Tag Info |
N-terminal 6xHis-tagged |
Theoretical MW |
18.6 kDa |
Purity |
>90% as determined by SDS-PAGE. |
Storage Buffer |
Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Endotoxin Level |
Not tested |
Biological Activity |
Not tested |
Shipping Condition |
Ice packs |
Storage |
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles. |
Expiry Date |
1 year |
Restriction |
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals. |
Relevance |
FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. |
Function |
FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. |
Subcellular location |
Cytoplasm |
Protein Families |
Calycin superfamily, Fatty-acid binding protein (FABP) family |
Tissue Specificity |
Heart, but also skeletal muscle, kidney, brain and mammary gland. |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.