Item no. |
BM-RPC23816-50ug |
Manufacturer |
Biomatik
|
Amount |
50ug |
Category |
|
Type |
Proteins Recombinant |
Specific against |
Human |
ECLASS 5.1 |
34160400 |
ECLASS 6.1 |
34160400 |
ECLASS 8.0 |
42020190 |
ECLASS 9.0 |
42020190 |
ECLASS 10.0.1 |
32160409 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
10KDA interferon gamma-induced protein Short name: Gamma-IP10 Short name: IP-10 Small-inducible cytokine B10 |
Similar products |
10KDA interferon gamma-induced protein Short name: Gamma-IP10 Short name: IP-10 Small-inducible cytokine B10 |
Available |
|
Gene Name |
CXCL10 |
Alternative Names |
10KDA interferon gamma-induced protein Short name: Gamma-IP10 Short name: IP-10 Small-inducible cytokine B10 |
Uniprot |
P02778 |
Source |
Mammalian cell |
Expression Region |
22-98aa |
AA Sequence |
VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQF CPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSK ERSKRSP |
Sequence Info |
Full Length of Mature Protein |
Tag Info |
N-terminal 6xHis-tagged |
Theoretical MW |
12.6 kDa |
Purity |
>90% as determined by SDS-PAGE. |
Storage Buffer |
Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Endotoxin Level |
Not tested |
Biological Activity |
Not tested |
Shipping Condition |
Ice packs |
Storage |
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles. |
Expiry Date |
1 year |
Restriction |
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals. |
Relevance |
Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3. |
Function |
Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3. |
Subcellular location |
Secreted |
Protein Families |
Intercrine alpha (chemokine CxC) family |
Paythway |
Chemokinesignalingpathway |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.