Item no. |
BM-RPC20838-100ug |
Manufacturer |
Biomatik
|
Amount |
100ug |
Category |
|
Type |
Proteins Recombinant |
Specific against |
Human |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Thioredoxin-binding protein 2 Vitamin D3 up-regulated protein 1 |
Similar products |
Thioredoxin-binding protein 2 Vitamin D3 up-regulated protein 1 |
Available |
|
Gene Name |
TXNIP |
Alternative Names |
Thioredoxin-binding protein 2 Vitamin D3 up-regulated protein 1 |
Uniprot |
Q9H3M7 |
Source |
in vitro E.coli expression system |
Expression Region |
1-391aa |
AA Sequence |
MVMFKKIKSFEVVFNDPEKVYGSGEKVAGRVIVEV CEVTRVKAVRILACGVAKVLWMQGSQQCKQTSEYL RYEDTLLLEDQPTGENEMVIMRPGNKYEYKFGFEL PQGPLGTSFKGKYGCVDYWVKAFLDRPSQPTQETK KNFEVVDLVDVNTPDLMAPVSAKKEKKVSCMFIPD GRVSVSARIDRKGFCEGDEISIHADFENTCSRIVV PKAAIVARHTYLANGQTKVLTQKLSSVRGNHIISG TCASWRGKSLRVQKIRPSILGCNILRVEYSLLIYV SVPGSKKVILDLPLVIGSRSGLSSRTSSMASRTSS EMSWVDLNIPDTPEAPPCYMDVIPEDHRLESPTTP LLDDMDGSQDSPIFMYAPEFKFMPPPTYTEVDPCI LNNNVQ |
Sequence Info |
Full Length |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
Theoretical MW |
59.7 kDa |
Purity |
>90% as determined by SDS-PAGE. |
Storage Buffer |
Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Endotoxin Level |
Not tested |
Biological Activity |
Not tested |
Shipping Condition |
Ice packs |
Storage |
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles. |
Expiry Date |
1 year |
Restriction |
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals. |
Relevance |
May act as an oxidative stress mediator by inhibiting thioredoxin activity or by limiting its bioavailability. Interacts with COPS5 and restores COPS5-induced suppression of CDKN1B stability, blocking the COPS5-mediated translocation of CDKN1B from the nucleus to the cytoplasm. Functions as a transcriptional repressor, possibly by acting as a bridge molecule between transcription factors and corepressor complexes, and over-expression will induce G0/G1 cell cycle arrest. Required for the maturation of natural killer cells. Acts as a suppressor of tumor cell growth. Inhibits the proteasomal degradation of DDIT4, and thereby contributes to the inhibition of the mammalian target of rapamycin complex 1 (mTORC1). |
Function |
May act as an oxidative stress mediator by inhibiting thioredoxin activity or by limiting its bioavailability. Interacts with COPS5 and restores COPS5-induced suppression of CDKN1B stability, blocking the COPS5-mediated translocation of CDKN1B from the nucleus to the cytoplasm. Functions as a transcriptional repressor, possibly by acting as a bridge molecule between transcription factors and corepressor complexes, and over-expression will induce G0/G1 cell cycle arrest. Required for the maturation of natural killer cells. Acts as a suppressor of tumor cell growth. Inhibits the proteasomal degradation of DDIT4, and thereby contributes to the inhibition of the mammalian target of rapamycin complex 1 (mTORC1). |
Subcellular location |
Cytoplasm |
Protein Families |
Arrestin family |
Paythway |
InflammasomeSignaling |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.