Comparison

Recombinant Mouse Interleukin-23 subunit alpha (Il23a)

Item no. BM-RPC20830-100ug
Manufacturer Biomatik
Amount 100ug
Category
Type Proteins Recombinant
Specific against Mouse
ECLASS 5.1 34160400
ECLASS 6.1 34160400
ECLASS 8.0 42020190
ECLASS 9.0 42020190
ECLASS 10.0.1 32160409
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Interleukin-23 subunit p19 Short name: IL-23p19
Similar products Interleukin-23 subunit p19 Short name: IL-23p19
Available
Gene Name
Il23a
Alternative Names
Interleukin-23 subunit p19 Short name: IL-23p19
Uniprot
Q9EQ14
Source
in vitro E.coli expression system
Expression Region
22-196aa
AA Sequence
VPRSSSPDWAQCQQLSRNLCMLAWNAHAPAGHMNL LREEEDEETKNNVPRIQCEDGCDPQGLKDNSQFCL QRIRQGLAFYKHLLDSDIFKGEPALLPDSPMEQLH TSLLGLSQLLQPEDHPRETQQMPSLSSSQQWQRPL LRSKILRSLQAFLAIAARVFAHGAATLTEPLVPTA
Sequence Info
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Theoretical MW
23.7 kDa
Purity
>90% as determined by SDS-PAGE.
Storage Buffer
Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level
Not tested
Biological Activity
Not tested
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Associates with IL12B to form the IL-23 interleukin, a heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in peripheral tissues. IL-23 binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak-Stat signaling cascade, stimulates memory rather than naive T-cells and promotes production of proinflammatory cytokines. IL-23 induces autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis.
Function
Associates with IL12B to form the IL-23 interleukin, a heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in peripheral tissues. IL-23 binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak-Stat signaling cascade, stimulates memory rather than naive T-cells and promotes production of proinflammatory cytokines. IL-23 induces autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis.
Subcellular location
Secreted
Protein Families
IL-6 superfamily
Tissue Specificity
Secreted by activated dendritic cells (at protein level). Detected in various tissues with higher expression in polarized Th1 cells and activated macrophages.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close