Item no. |
BM-RPC20810-50ug |
Manufacturer |
Biomatik
|
Amount |
50ug |
Category |
|
Type |
Proteins Recombinant |
Specific against |
Human |
ECLASS 5.1 |
34160400 |
ECLASS 6.1 |
34160400 |
ECLASS 8.0 |
42020190 |
ECLASS 9.0 |
42020190 |
ECLASS 10.0.1 |
32160409 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Cyclic nucleotide-gated channel alpha-4 Short name: CNG channel alpha-4 Short name: CNG-4 Short name: CNG4 |
Similar products |
Cyclic nucleotide-gated channel alpha-4 Short name: CNG channel alpha-4 Short name: CNG-4 Short name: CNG4 |
Available |
|
Gene Name |
CNGA4 |
Alternative Names |
Cyclic nucleotide-gated channel alpha-4 Short name: CNG channel alpha-4 Short name: CNG-4 Short name: CNG4 |
Uniprot |
Q8IV77 |
Source |
in vitro E.coli expression system |
Expression Region |
1-575aa |
AA Sequence |
MSQDTKVKTTESSPPAPSKARKLLPVLDPSGDYYY WWLNTMVFPVMYNLIILVCRACFPDLQHGYLVAWL VLDYTSDLLYLLDMVVRFHTGFLEQGILVVDKGRI SSRYVRTWSFFLDLASLMPTDVVYVRLGPHTPTLR LNRFLRAPRLFEAFDRTETRTAYPNAFRIAKLMLY IFVVIHWNSCLYFALSRYLGFGRDAWVYPDPAQPG FERLRRQYLYSFYFSTLILTTVGDTPPPAREEEYL FMVGDFLLAVMGFATIMGSMSSVIYNMNTADAAFY PDHALVKKYMKLQHVNRKLERRVIDWYQHLQINKK MTNEVAILQHLPERLRAEVAVSVHLSTLSRVQIFQ NCEASLLEELVLKLQPQTYSPGEYVCRKGDIGQEM YIIREGQLAVVADDGITQYAVLGAGLYFGEISIIN IKGNMSGNRRTANIKSLGYSDLFCLSKEDLREVLS EYPQAQTIMEEKGREILLKMNKLDVNAEAAEIALQ EATESRLRGLDQQLDDLQTKFARLLAELESSALKI AYRIERLEWQTREWPMPEDLAEADDEGEPEEGTSK DEEGRASQEGPPGPE |
Sequence Info |
Full Length |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
Theoretical MW |
82 kDa |
Purity |
>90% as determined by SDS-PAGE. |
Storage Buffer |
Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Endotoxin Level |
Not tested |
Biological Activity |
Not tested |
Shipping Condition |
Ice packs |
Storage |
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles. |
Expiry Date |
1 year |
Restriction |
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals. |
Relevance |
Second messenger, cAMP, causes the opening of cation-selective cyclic nucleotide-gated (CNG) channels and depolarization of the neuron (olfactory sensory neurons, OSNs). CNGA4 is the modulatory subunit of this channel which is known to play a central role in the transduction of odorant signals and subsequent adaptation. By accelerating the calcium-mediated negative feedback in olfactory signaling it allows rapid adaptation to odor stimulation and extends its range of odor detection (By similarity). |
Function |
Second messenger, cAMP, causes the opening of cation-selective cyclic nucleotide-gated (CNG) channels and depolarization of the neuron (olfactory sensory neurons, OSNs). CNGA4 is the modulatory subunit of this channel which is known to play a central role in the transduction of odorant signals and subsequent adaptation. By accelerating the calcium-mediated negative feedback in olfactory signaling it allows rapid adaptation to odor stimulation and extends its range of odor detection (By similarity). |
Subcellular location |
Membrane, Multi-pass membrane protein |
Protein Families |
Cyclic nucleotide-gated cation channel (TC 1.A.1.5) family, CNGA4 subfamily |
Paythway |
cAMPsignalingpathway |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.