« Back
Home /
Recombinant Human Transmembrane protein PVRIG (PVRIG)

Recombinant Human Transmembrane protein PVRIG (PVRIG)

Item no.	BM-RPC20803-100ug
Manufacturer	Biomatik
Amount	100ug
Category	Neuroscience Neural Adhesion Molecules Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	CD112 receptor Short name: CD112R Poliovirus receptor-related immunoglobulin domain-containing protein C7orf15
Similar products	CD112 receptor Short name: CD112R Poliovirus receptor-related immunoglobulin domain-containing protein C7orf15
Available
Gene Name	PVRIG
Alternative Names	CD112 receptor Short name: CD112R Poliovirus receptor-related immunoglobulin domain-containing protein C7orf15
Uniprot	Q6DKI7
Source	in vitro E.coli expression system
Expression Region	1-326aa
AA Sequence	MRTEAQVPALQPPEPGLEGAMGHRTLVLPWVLLTL CVTAGTPEVWVQVRMEATELSSFTIRCGFLGSGSI SLVTVSWGGPNGAGGTTLAVLHPERGIRQWAPARQ ARWETQSSISLILEGSGASSPCANTTFCCKFASFP EGSWEACGSLPPSSDPGLSAPPTPAPILRADLAGI LGVSGVLLFGCVYLLHLLRRHKHRPAPRLQPSRTS PQAPRARAWAPSQASQAALHVPYATINTSCRPATL DTAHPHGGPSWWASLPTHAAHRPQGPAAWASTPIP ARGSFVSVENGLYAQAGERPPHTGPGLTLFPDPRG PRAMEGPLGVR
Sequence Info	Full Length
Tag Info	N-terminal 6xHis-SUMO-tagged
Theoretical MW	50.3 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Cell surface receptor for NECTIN2. May act as a coinhibitory receptor that suppresses T-cell receptor-mediated signals. Following interaction with NECTIN2, inhibits T-cell proliferation. Competes with CD226 for NECTIN2-binding.
Function	Cell surface receptor for NECTIN2. May act as a coinhibitory receptor that suppresses T-cell receptor-mediated signals. Following interaction with NECTIN2, inhibits T-cell proliferation. Competes with CD226 for NECTIN2-binding.
Subcellular location	Cell membrane, Multi-pass membrane protein
Tissue Specificity	Expressed in some types of immune cells. Expressed at low levels on the surface of freshly isolated T-cells and natural killer (NK) cells, predominantly on CD8+ T-cells (mainly memory/effector, but not naive cells) and on both CD16+ and CD16- NK cells. T-cell expression levels are variable among individuals. Not detected in B-cells, naive or helper T-cells, monocytes, nor neutrophils (at protein level). Not detected in dendritic cells.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Delivery expected until 8/30/2024

Express Delivery: Save 7 days

Compare

Add to wishlist

Recommend by mail