Comparison

Recombinant Human Bone marrow proteoglycan (PRG2), partial

Item no. BM-RPC20746-50ug
Manufacturer Biomatik
Amount 50ug
Category
Type Proteins Recombinant
Specific against Human
ECLASS 5.1 34160400
ECLASS 6.1 34160400
ECLASS 8.0 42020190
ECLASS 9.0 42020190
ECLASS 10.0.1 32160409
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Proteoglycan 2 Cleaved into the following chain: Eosinophil granule major basic protein Short name: EMBP
Similar products Proteoglycan 2 Cleaved into the following chain: Eosinophil granule major basic protein Short name: EMBP
Available
Gene Name
PRG2
Alternative Names
Proteoglycan 2 Cleaved into the following chain: Eosinophil granule major basic protein Short name: EMBP
Uniprot
P13727
Source
in vitro E.coli expression system
Expression Region
106-222aa
AA Sequence
TCRYLLVRSLQTFSQAWFTCRRCYRGNLVSIHNFN INYRIQCSVSALNQGQVWIGGRITGSGRCRRFQWV DGSRWNFAYWAAHQPWSRGGHCVALCTRGGHWRRA HCLRRLPFICSY
Sequence Info
Partial
Tag Info
N-terminal 6xHis-tagged
Theoretical MW
17.8 kDa
Purity
>90% as determined by SDS-PAGE.
Storage Buffer
Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level
Not tested
Biological Activity
Not tested
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Cytotoxin and helminthotoxin. Also induces non-cytolytic histamine release from human basophils. Involved in antiparasitic defense mechanisms and immune hypersensitivity reactions. The proform acts as a proteinase inhibitor, reducing the activity of PAPPA.
Function
Cytotoxin and helminthotoxin. Also induces non-cytolytic histamine release from human basophils. Involved in antiparasitic defense mechanisms and immune hypersensitivity reactions. The proform acts as a proteinase inhibitor, reducing the activity of PAPPA.
Subcellular location
Bone marrow proteoglycan: Secreted, Note=The proform is secreted, SUBCELLULAR LOCATION: Eosinophil granule major basic protein: Cytoplasmic vesicle, secretory vesicle
Tissue Specificity
High levels of the proform in placenta and pregnancy serum; in placenta, localized to X cells of septa and anchoring villi. Lower levels in a variety of other tissues including kidney, myometrium, endometrium, ovaries, breast, prostate, bone marrow and colon.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close