Item no. |
BM-RPC20659-50ug |
Manufacturer |
Biomatik
|
Amount |
50ug |
Category |
|
Type |
Proteins Recombinant |
Specific against |
Human |
ECLASS 5.1 |
34160400 |
ECLASS 6.1 |
34160400 |
ECLASS 8.0 |
42020190 |
ECLASS 9.0 |
42020190 |
ECLASS 10.0.1 |
32160409 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
La autoantigen La ribonucleoprotein Sjoegren syndrome type B antigen Short name:SS-B |
Similar products |
La autoantigen La ribonucleoprotein Sjoegren syndrome type B antigen Short name:SS-B |
Available |
|
Gene Name |
SSB |
Alternative Names |
La autoantigen La ribonucleoprotein Sjoegren syndrome type B antigen Short name:SS-B |
Uniprot |
P05455 |
Source |
Baculovirus |
Expression Region |
1-408aa |
AA Sequence |
MAENGDNEKMAALEAKICHQIEYYFGDFNLPRDKF LKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNVIVE ALSKSKAELMEISEDKTKIRRSPSKPLPEVTDEYK NDVKNRSVYIKGFPTDATLDDIKEWLEDKGQVLNI QMRRTLHKAFKGSIFVVFDSIESAKKFVETPGQKY KETDLLILFKDDYFAKKNEERKQNKVEAKLRAKQE QEAKQKLEEDAEMKSLEEKIGCLLKFSGDLDDQTC REDLHILFSNHGEIKWIDFVRGAKEGIILFKEKAK EALGKAKDANNGNLQLRNKEVTWEVLEGEVEKEAL KKIIEDQQESLNKWKSKGRRFKGKGKGNKAAQPGS GKGKVQFQGKKTKFASDDEHDEHDENGATGPVKRA REETDKEEPASKQQKTENGAGDQ |
Sequence Info |
Full Length |
Tag Info |
N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Theoretical MW |
50.8 kDa |
Purity |
>85% as determined by SDS-PAGE. |
Storage Buffer |
Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Endotoxin Level |
Not tested |
Biological Activity |
Not tested |
Shipping Condition |
Ice packs |
Storage |
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles. |
Expiry Date |
1 year |
Restriction |
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals. |
Relevance |
Binds to the 3' poly(U) terminus of nascent RNA polymerase III transcripts, protecting them from exonuclease digestion and facilitating their folding and maturation. In case of Coxsackievirus B3 infection, binds to the viral internal ribosome entry site (IRES) and stimulates the IRES-mediated translation |
Function |
Binds to the 3' poly(U) terminus of nascent RNA polymerase III transcripts, protecting them from exonuclease digestion and facilitating their folding and maturation |
Subcellular location |
Nucleus |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.