Manufacturer |
Biomatik
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
Mouse |
Amount |
50ug |
Item no. |
BM-RPC20654-50ug |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Alias |
Plasminogen activator inhibitor 3 Short name: PAI-3 Short name: PAI3 Protein C inhibitor Short name: PCI Serpin A5 Pci |
Gene Name |
Serpina5 |
Alternative Names |
Plasminogen activator inhibitor 3 Short name: PAI-3 Short name: PAI3 Protein C inhibitor Short name: PCI Serpin A5 Pci |
Uniprot |
P70458 |
Source |
Baculovirus |
Expression Region |
25-405aa |
AA Sequence |
SKKKKAKESSVGAVGPPSSKDFAFRLYRALVSESP GQNVFFSPLSVSMSLGMLSLGAGLKTKTQILDGLG LSLQQGQEDKLHKGFQQLLQRFRQPSDGLQLSLGS ALFKDPAVHIRDDFLSAMKTLYMSDTFSTNFGNPE IAKKQINNYVAKQTKGKIVDFIKDLDSTHVMIVVN YIFFKAKWQTAFSETNTHKMDFHVTPKRTTQVPMM NREDGYSYYLDQNISCTVVGIPYQGNAIALFILPS EGKMKQVEDGLDERTLRNWLKMFTKRRLDLYLPKF SIEATYKLENVLPKLGIQDVFTTHADLSGITDHTN IKLSEMVHKSMMEVEESGTTAAAITGAIFTFRSAR PSSLKIEFTRPFLLTLMEDSHILFVGKVTRP |
Sequence Info |
Full Length of Mature Protein |
Tag Info |
N-terminal 10xHis-tagged |
Theoretical MW |
45.3 kDa |
Purity |
>90% as determined by SDS-PAGE. |
Storage Buffer |
Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Endotoxin Level |
Not tested |
Biological Activity |
Not tested |
Shipping Condition |
Ice packs |
Storage |
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles. |
Expiry Date |
1 year |
Restriction |
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals. |
Relevance |
Heparin-dependent serine protease inhibitor acting in body fluids and secretions. Inactivates serine proteases by binding irreversibly to their serine activation site. Involved in the regulation of intravascular and extravascular proteolytic activities. Plays hemostatic roles in the blood plasma. Acts as a procoagulant and proinflammatory factor by inhibiting the anticoagulant activated protein C factor as well as the generation of activated protein C factor by the thrombin/thrombomodulin complex. Acts as an anticoagulant factor by inhibiting blood coagulation factors like prothrombin, factor XI, factor Xa, plasma kallikrein and fibrinolytic enzymes such as tissue- and urinary-type plasminogen activators. In seminal plasma, inactivates several serine proteases implicated in the reproductive system. Inhibits the serpin acrosin; indirectly protects component of the male genital tract from being degraded by excessive released acrosin. Inhibits tissue-and urinary-type plasminogen activator, prostate-specific antigen and kallikrein activities; has a control on the sperm motility and fertilization. Inhibits the activated protein C-catalyzed degradation of SEMG1 and SEMG2; regulates the degradation of semenogelin during the process of transfer of spermatozoa from the male reproductive tract into the female tract. In urine, inhibits urinary-type plasminogen activator and kallikrein activities. Inactivates membrane-anchored serine proteases activities such as MPRSS7 and TMPRSS11E. Inhibits urinary-type plasminogen activator-dependent tumor cell invasion and metastasis. May also play a non-inhibitory role in seminal plasma and urine as a hydrophobic hormone carrier by its binding to retinoic acid |
Function |
Heparin-dependent serine protease inhibitor acting in body fluids and secretions. Inactivates serine proteases by binding irreversibly to their serine activation site. Involved in the regulation of intravascular and extravascular proteolytic activities. Plays hemostatic roles in the blood plasma. Acts as a procoagulant and proinflammatory factor by inhibiting the anticoagulant activated protein C factor as well as the generation of activated protein C factor by the thrombin/thrombomodulin complex. Acts as an anticoagulant factor by inhibiting blood coagulation factors like prothrombin, factor XI, factor Xa, plasma kallikrein and fibrinolytic enzymes such as tissue- and urinary-type plasminogen activators. In seminal plasma, inactivates several serine proteases implicated in the reproductive system. Inhibits the serpin acrosin; indirectly protects component of the male genital tract from being degraded by excessive released acrosin. Inhibits tissue-and urinary-type plasminogen activator, prostate-specific antigen and kallikrein activities; has a control on the sperm motility and fertilization. Inhibits the activated protein C-catalyzed degradation of SEMG1 and SEMG2; regulates the degradation of semenogelin during the process of transfer of spermatozoa from the male reproductive tract into the female tract. In urine, inhibits urinary-type plasminogen activator and kallikrein activities. Inactivates membrane-anchored serine proteases activities such as MPRSS7 and TMPRSS11E. Inhibits urinary-type plasminogen activator-dependent tumor cell invasion and metastasis. May also play a non-inhibitory role in seminal plasma and urine as a hydrophobic hormone carrier by its binding to retinoic acid (By similarity). |
Subcellular location |
Secreted, extracellular space |
Protein Families |
Serpin family |
Tissue Specificity |
Not detected in blood plasma (at protein level). Expressed in testis, epididymis, seminal vesicles, prostate and ovaries. |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.