« Back
Home /
Recombinant Macaca mulatta Interleukin-10 (IL10)

Recombinant Macaca mulatta Interleukin-10 (IL10)

Item no.	BM-RPC20637-50ug
Manufacturer	Biomatik
Amount	50ug
Category	Neuroscience Neuroinflammation Peptides & Proteins Recombinant Proteins Cell Biology Cell Culture Cytokines
Type	Proteins Recombinant
Specific against	other
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Cytokine synthesis inhibitory factor
Similar products	Cytokine synthesis inhibitory factor
Available
Gene Name	IL10
Alternative Names	Cytokine synthesis inhibitory factor
Uniprot	P51496
Source	Baculovirus
Expression Region	19-178aa
AA Sequence	SPGQGTQSENSCTRFPGNLPHMLRDLRDAFSRVKT FFQMKDQLDNILLKESLLEDFKGYLGCQALSEMIQ FYLEEVMPQAENHDPDIKEHVNSLGENLKTLRLRL RRCHRFLPCENKSKAVEQVKNAFSKLQEKGVYKAM SEFDIFINYIEAYMTMKIQN
Sequence Info	Full Length of Mature Protein
Tag Info	C-terminal 10xHis-tagged
Theoretical MW	21.2 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells.
Function	Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells.
Subcellular location	Secreted
Protein Families	IL-10 family

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Delivery expected until 8/30/2024