Comparison

Recombinant Human Tyrosine-protein kinase BTK (BTK)

Item no. BM-RPC20617-50ug
Manufacturer Biomatik
Amount 50ug
Category
Type Proteins Recombinant
Specific against Human
ECLASS 5.1 34160400
ECLASS 6.1 34160400
ECLASS 8.0 42020190
ECLASS 9.0 42020190
ECLASS 10.0.1 32160409
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Agammaglobulinemia tyrosine kinase Short name: ATK B-cell progenitor kinase Short name: BPK Bruton tyrosine kinase AGMX1
Similar products Agammaglobulinemia tyrosine kinase Short name: ATK B-cell progenitor kinase Short name: BPK Bruton tyrosine kinase AGMX1
Available
Gene Name
BTK
Alternative Names
Agammaglobulinemia tyrosine kinase Short name: ATK B-cell progenitor kinase Short name: BPK Bruton tyrosine kinase AGMX1
Uniprot
Q06187
Source
Baculovirus
Expression Region
1-659aa
AA Sequence
MAAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVH KLSYYEYDFERGRRGSKKGSIDVEKITCVETVVPE KNPPPERQIPRRGEESSEMEQISIIERFPYPFQVV YDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQ KYHPCFWIDGQYLCCSQTAKNAMGCQILENRNGSL KPGSSHRKTKKPLPPTPEEDQILKKPLPPEPAAAP VSTSELKKVVALYDYMPMNANDLQLRKGDEYFILE ESNLPWWRARDKNGQEGYIPSNYVTEAEDSIEMYE WYSKHMTRSQAEQLLKQEGKEGGFIVRDSSKAGKY TVSVFAKSTGDPQGVIRHYVVCSTPQSQYYLAEKH LFSTIPELINYHQHNSAGLISRLKYPVSQQNKNAP STAGLGYGSWEIDPKDLTFLKELGTGQFGVVKYGK WRGQYDVAIKMIKEGSMSEDEFIEEAKVMMNLSHE KLVQLYGVCTKQRPIFIITEYMANGCLLNYLREMR HRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAAR NCLVNDQGVVKVSDFGLSRYVLDDEYTSSVGSKFP VRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGK MPYERFTNSETAEHIAQGLRLYRPHLASEKVYTIM YSCWHEKADERPTFKILLSNILDVMDEES
Sequence Info
Full Length of Isoform BTK-A
Tag Info
N-terminal 10xHis-tagged
Theoretical MW
78.3 kDa
Purity
>90% as determined by SDS-PAGE.
Storage Buffer
Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level
Not tested
Biological Activity
Not tested
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Non-receptor tyrosine kinase indispensable for B lymphocyte development, differentiation and signaling. Binding of antigen to the B-cell antigen receptor (BCR) triggers signaling that ultimately leads to B-cell activation. After BCR engagement and activation at the plasma membrane, phosphorylates PLCG2 at several sites, igniting the downstream signaling pathway through calcium mobilization, followed by activation of the protein kinase C (PKC) family members. PLCG2 phosphorylation is performed in close cooperation with the adapter protein B-cell linker protein BLNK. BTK acts as a platform to bring together a diverse array of signaling proteins and is implicated in cytokine receptor signaling pathways. Plays an important role in the function of immune cells of innate as well as adaptive immunity, as a component of the Toll-like receptors (TLR) pathway. The TLR pathway acts as a primary surveillance system for the detection of pathogens and are crucial to the activation of host defense. Especially, is a critical molecule in regulating TLR9 activation in splenic B-cells. Within the TLR pathway, induces tyrosine phosphorylation of TIRAP which leads to TIRAP degradation. BTK plays also a critical role in transcription regulation. Induces the activity of NF-kappa-B, which is involved in regulating the expression of hundreds of genes. BTK is involved on the signaling pathway linking TLR8 and TLR9 to NF-kappa-B. Transiently phosphorylates transcription factor GTF2I on tyrosine residues in response to BCR. GTF2I then translocates to the nucleus to bind regulatory enhancer elements to modulate gene expression. ARID3A and NFAT are other transcriptional target of BTK. BTK is required for the formation of functional ARID3A DNA-binding complexes. There is however no evidence that BTK itself binds directly to DNA. BTK has a dual role in the regulation of apoptosis.
Function
Non-receptor tyrosine kinase indispensable for B lymphocyte development, differentiation and signaling. Binding of antigen to the B-cell antigen receptor (BCR) triggers signaling that ultimately leads to B-cell activation. After BCR engagement and activation at the plasma membrane, phosphorylates PLCG2 at several sites, igniting the downstream signaling pathway through calcium mobilization, followed by activation of the protein kinase C (PKC) family members. PLCG2 phosphorylation is performed in close cooperation with the adapter protein B-cell linker protein BLNK. BTK acts as a platform to bring together a diverse array of signaling proteins and is implicated in cytokine receptor signaling pathways. Plays an important role in the function of immune cells of innate as well as adaptive immunity, as a component of the Toll-like receptors (TLR) pathway. The TLR pathway acts as a primary surveillance system for the detection of pathogens and are crucial to the activation of host defense. Especially, is a critical molecule in regulating TLR9 activation in splenic B-cells. Within the TLR pathway, induces tyrosine phosphorylation of TIRAP which leads to TIRAP degradation. BTK plays also a critical role in transcription regulation. Induces the activity of NF-kappa-B, which is involved in regulating the expression of hundreds of genes. BTK is involved on the signaling pathway linking TLR8 and TLR9 to NF-kappa-B. Transiently phosphorylates transcription factor GTF2I on tyrosine residues in response to BCR. GTF2I then translocates to the nucleus to bind regulatory enhancer elements to modulate gene expression. ARID3A and NFAT are other transcriptional target of BTK. BTK is required for the formation of functional ARID3A DNA-binding complexes. There is however no evidence that BTK itself binds directly to DNA. BTK has a dual role in the regulation of apoptosis.
Involvement in disease
X-linked agammaglobulinemia (XLA); X-linked hypogammaglobulinemia and isolated growth hormone deficiency (XLA-IGHD)
Subcellular location
Cytoplasm, Cell membrane, Peripheral membrane protein, Nucleus
Protein Families
Protein kinase superfamily, Tyr protein kinase family, TEC subfamily
Tissue Specificity
Predominantly expressed in B-lymphocytes.
Paythway
NF-kappaBsignalingpathway

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close