Item no. |
BM-RPC20594-50ug |
Manufacturer |
Biomatik
|
Amount |
50ug |
Category |
|
Type |
Proteins Recombinant |
Specific against |
Human |
ECLASS 5.1 |
34160400 |
ECLASS 6.1 |
34160400 |
ECLASS 8.0 |
42020190 |
ECLASS 9.0 |
42020190 |
ECLASS 10.0.1 |
32160409 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
PLP phosphatase Alternative name(s): Chronophin |
Similar products |
PLP phosphatase Alternative name(s): Chronophin |
Available |
|
Gene Name |
PDXP |
Alternative Names |
PLP phosphatase Alternative name(s): Chronophin |
Uniprot |
Q96GD0 |
Source |
Baculovirus |
Expression Region |
1-296aa |
AA Sequence |
MARCERLRGAALRDVLGRAQGVLFDCDGVLWNGER AVPGAPELLERLARAGKAALFVSNNSRRARPELAL RFARLGFGGLRAEQLFSSALCAARLLRQRLPGPPD APGAVFVLGGEGLRAELRAAGLRLAGDPSAGDGAA PRVRAVLVGYDEHFSFAKLREACAHLRDPECLLVA TDRDPWHPLSDGSRTPGTGSLAAAVETASGRQALV VGKPSPYMFECITENFSIDPARTLMVGDRLETDIL FGHRCGMTTVLTLTGVSRLEEAQAYLAAGQHDLVP HYYVESIADLTEGLED |
Sequence Info |
Full Length |
Tag Info |
C-terminal 9xHis-tagged |
Theoretical MW |
33.7 kDa |
Purity |
>90% as determined by SDS-PAGE. |
Storage Buffer |
Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Endotoxin Level |
Not tested |
Biological Activity |
Not tested |
Shipping Condition |
Ice packs |
Storage |
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles. |
Expiry Date |
1 year |
Restriction |
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals. |
Relevance |
Protein serine phosphatase that dephosphorylates 'Ser-3' in cofilin and probably also dephosphorylates phospho-serine residues in DSTN. Regulates cofilin-dependent actin cytoskeleton reorganization. Required for normal progress through mitosis and normal cytokinesis. Does not dephosphorylate phospho-threonines in LIMK1. Does not dephosphorylate peptides containing phospho-tyrosine. Pyridoxal phosphate phosphatase. Has some activity towards pyridoxal 5'-phosphate (PLP), pyridoxine 5'-phosphate (PMP) and pyridoxine 5'-phosphate (PNP), with a highest activity with PLP followed by PNP.2 Publications. |
Function |
Protein serine phosphatase that dephosphorylates 'Ser-3' in cofilin and probably also dephosphorylates phospho-serine residues in DSTN. Regulates cofilin-dependent actin cytoskeleton reorganization. Required for normal progress through mitosis and normal cytokinesis. Does not dephosphorylate phospho-threonines in LIMK1. Does not dephosphorylate peptides containing phospho-tyrosine |
Subcellular location |
Cytoplasm, cytosol, Cytoplasm, cytoskeleton, Cell projection, ruffle membrane, Peripheral membrane protein, Cytoplasmic side, Cell projection, lamellipodium membrane, Peripheral membrane protein, Cytoplasmic side, Cell membrane, Peripheral membrane protein, Cytoplasmic side |
Protein Families |
HAD-like hydrolase superfamily |
Tissue Specificity |
Ubiquitously expressed (at protein level) (PubMed:23223568). Highly expressed in all the regions of central nerve system except the spinal cord. Also expressed at high level in liver and testis. In fetus, it is weakly expressed in all organs except brain (PubMed:14522954, PubMed:15580268). |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.