« Back
Home /
Anti-FGF3 Antibody

Anti-FGF3 Antibody

Item no.	ANTI-A93060-100
Manufacturer	Antibodies.com
Amount	100ul
Format	Liquid
Applications	WB
Specific against	Rat
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Formula	Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Sequence	MGLIWLLLLSLLEPGWPAAGPGARLRRDAGGRGGVYEHLGGAPRRRKLYCATKYHLQLHPSGRVNGSLENSAYSILEITAVEVGIVAIRGLFSGRYLAMN
Available
Product Description	Rabbit polyclonal antibody to FGF3.
Clonality	Polyclonal
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FGF3 (NP_005238.1).
Product form	Liquid
Molecular weight	27 kDa
Formulation	Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Purification	Affinity purification.
Storage	Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Recommended dilutions	WB: 1:500-1:2, 000

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ul

available

Delivery expected until 9/6/2024

Express Delivery: Save 10 days

Compare

Add to wishlist

Recommend by mail