« Back
Home /
Anti-muscle Actin Antibody [ARC1912]

Anti-muscle Actin Antibody [ARC1912]

Item no.	ANTI-A305819-50
Manufacturer	Antibodies.com
Amount	50ul
Format	Liquid
Applications	WB, IHC, ICC
Clone	ARC1912
Specific against	Human, Mouse, Rat
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Formula	Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.
Sequence	ETTYNSIMKCDIDIRKDLYANNVMSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWITKQEYDEAGPSIVHRKCF
Available
Product Description	Rabbit monoclonal [ARC1912] antibody to muscle Actin.
Clonality	Monoclonal
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 278-377 of human a-Actin-1 (ACTA1) (P68133).
Product form	Liquid
Molecular weight	42 kDa
Formulation	Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.
Purification	Affinity purification.
Storage	Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Recommended dilutions	WB: 1:500-1:2, 000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200
Target	muscle Actin

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ul

available

Delivery expected until 9/6/2024

Express Delivery: Save 9 days

Compare

Add to wishlist

Recommend by mail