« Back
Home /
[Novoprotein] Recombinant E. coli Methionine Aminopeptidase/MetAP/MAP (C-6His)

[Novoprotein] Recombinant E. coli Methionine Aminopeptidase/MetAP/MAP (C-6His)

Item no.	C151-10ug
Manufacturer	Bon Opus
Amount	10ug
Category	Peptides & Proteins Enzymes
Type	Proteins Recombinant
Format	Liquid
Specific against	E.coli
Host	E.coli
Conjugate/Tag	His
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Sequence	AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGV STGELDRICNDYIVNEQHAVSACLGYHGYPKSVCI SINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFH GDTSKMFIVGKPTIMGERLCRITQESLYLALRMVK PGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRG FHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGK KEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCE ILT
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Methionine Aminopeptidase, MAP, Peptidase M, map
Similar products	peptidase-m
Available
Background	Methionine Aminopeptidase (MAP) is a member of the peptidase M24A family. MAP is essential for cell growth because it plays a central role for protein maturation as it removes the initiator Met residue from newly synthesized proteins.
Description	Recombinant E.coli Methionine Aminopeptidase is produced by our E.coli expression system & the target gene encoding Ala2-Glu264 is expressed with a 6His tag at the C-terminus.
Endotoxin	Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Formulation	Supplied as a 0.2 um filtered solution of 20mM TrisHCl, 100mM NaCl, 50% Glycerol, pH 8.0.
Molecular Weight	30, 4
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Seq Length	Ala2-Glu264
Ship Description	The product is shipped on dry ice/ice packs.
Storage	Store at < -20C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time