Comparison

Recombinant Mouse Cystatin E/CST6 (C-6His)

Item no. CD44-1mg
Manufacturer Bon Opus
Amount 1mg
Category
Type Proteins Recombinant
Format Liquid
Specific against Mouse
Host Human
Conjugate/Tag His
Purity Greater than 95% as determined by reducing SDS-PAGE.
Sequence ELRSRRTGERQNLSPTDPRVQKAAQAAVASYNMGS DSLYYFRDTKVIDAKYQLVAGIKYYLTLDIESTEC RKTRVSGEHMDLTTCPLAAGGQQEKLRCNFELLEV PWKNTTQLLKHDCVQVVDHHHHHH
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Cystatin E/M, Cst6.
Similar products CST6
Available
Background
Mouse CST6 is a member of the family 2 of the cystatin superfamily. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids & secretions, where they appear to provide protective functions. CST6 is expressed in heart, liver & kidney. In addition to its function as a cysteine protease inhibitor, CST6 also serves as a target for cross-linking by transglutaminases. Accordingly, CST6 was suggested to be involved in barrier formation & maintenance. Furthermore, studies have revealed that CST6 is frequently epigenetically inactivated during breast carcinogenesis, & thus be regarded as a candidate of tumour suppressor gene.
Description
Recombinant Mouse Cystatin E/M is produced by our Mammalian expression system & the target gene encoding Glu29-Val149 is expressed with a 6His tag at the C-terminus.
Endotoxin
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Formulation
Supplied as a 0.2 um filtered solution of 20mM MES, 150mM NaCl, pH 7.4.
Molecular Weight
14, 8
Reconstitution
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Seq Length
Glu29-Val149
Ship Description
The product is shipped on dry ice/ice packs.
Storage
Store at < -20C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close