Item no. |
CD21-500ug |
Manufacturer |
Bon Opus
|
Amount |
500ug |
Category |
|
Type |
Proteins Recombinant |
Format |
Lyophilized |
Specific against |
Mouse |
Host |
Human |
Conjugate/Tag |
His |
Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
Sequence |
LPLRESHTAHQATDFGVKVFQQVVQASKDRNVVFS PYGVSSVLAMLQMTTAGKTRRQIQDAMGFKVNEKG TAHALRQLSKELMGPWNKNEISTADAIFVQRDLEL VQGFMPHFFKLFQTMVKQVDFSEVERARFIINDWV ERHTKGMISDLLAKGAVDELTRLVLVNALYFSGQW KTPFLEASTHQRLFHKSDGSTVSVPMMAQSNKFNY TEFTTPDGLEYDVVELPYQGDTLSMFIAAPFEKDV HLS |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Plasminogen activator inhibitor 1, Endothelial plasminogen activator inhibitor, Serpin E1, Mr1, Pai1, Planh1, |
Similar products |
SERPIN E1 |
Available |
|
Background |
Plasminogen activator inhibitor-1 (serpin E1) is a serine protease inhibitor which belongs to the serpin family. Serpin E1 acts as 'bait' for tissue plasminogen activator, urokinase, protein C & matriptase-3/TMPRSS7. Its rapid interaction with PLAT may function as a major control point in the regulation of fibrinolysis. |
Description |
Recombinant Mouse Serpin E1/PAI-1 is produced by our Mammalian expression system & the target gene encoding Leu24-Ser402 is expressed with a 6His tag at the C-terminus. |
Endotoxin |
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test. |
Formulation |
Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH7.4. |
Molecular Weight |
43, 7 |
Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Seq Length |
Leu24-Ser402 |
Ship Description |
The product is shipped at ambient temperature. |
Storage |
Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7C for 2-7 days. Aliquots of reconstituted samples are stable at < -20C for 3 months. |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.