Item no. |
CD20-1mg |
Manufacturer |
Bon Opus
|
Amount |
1mg |
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid |
Specific against |
Mouse |
Host |
Human |
Conjugate/Tag |
His |
Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
Sequence |
ARPPDFCSKDLISSVKPGFPKTIETNNPGVLKAAR HSVEKFNNCTNDIFLFKESHVSKALVQVVKGLKYM LEVKIGRTTCRKTMHHQLDNCDFQTNPALKRTLYC YSEVWVIPWLHSFEVPVLLCQVDHHHHHH |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Cystatin-F, Cystatin-like Metastasis-Associated Protein, Leukocystatin, CMAP, Cystatin-7, Cst7, |
Similar products |
Cystatin F |
Available |
|
Background |
Mouse Cystatin F belongs to cystatin superfamily, which encompasses proteins that contain multiple cystatin-like sequences. It has been shown that Cystatin F is selectively expressed by hematopoietic cells & may be a biomarker for both liver metastasis & inflammatory lung disorders. Mouse Cystatin F inhibits papain & cathepsin L but with affinities lower than other cystatins. It may play a role in immune regulation through inhibition of a unique target in the hematopoietic system. |
Description |
Recombinant Mouse Cystatin F is produced by our Mammalian expression system & the target gene encoding Ala19-Gln144 is expressed with a 6His tag at the C-terminus. |
Endotoxin |
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test. |
Formulation |
Supplied as a 0.2 um filtered solution of 20mM Tris, 150mM NaCl, pH 8.0. |
Molecular Weight |
15, 4 |
Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Seq Length |
Ala19-Gln144 |
Ship Description |
The product is shipped on dry ice/ice packs. |
Storage |
Store at < -20C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.