« Back
Home /
Recombinant Mouse VEGF-D/PIGF (C-6His)

Recombinant Mouse VEGF-D/PIGF (C-6His)

Item no.	CD18-1mg
Manufacturer	Bon Opus
Amount	1mg
Category	Oncology Neuroscience Neural Lineage Markers Neural Signaling By Cell Type Carcinoma Peptides & Proteins Recombinant Proteins Cell Biology Cell Culture Cytokines Adenocarcinoma By Organ Bladder Cancer Neuronal Cell Markers
Type	Proteins Recombinant
Format	Liquid
Specific against	Mouse
Host	Human
Conjugate/Tag	His
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Sequence	FYDTETLKVIDEEWQRTQCSPRETCVEVASELGKT TNTFFKPPCVNVFRCGGCCNEEGVMCMNTSTSYIS KQLFEISVPLTSVPELVPVKIANHTGCKCLPTGPR HPYSVDHHHHHH
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Vascular endothelial growth factor D, c-Fos-induced growth factor, FIGF, VEGFD,
Similar products	VEGFD
Available
Background	Mouse vascular endothelial growth factor D, (VEGFD) is a member of the platelet-derived growth factor/vascular endothelial growth factor (PDGF/VEGF) family. VEGFD is a secreted protein & highly expressed in fetal & adult lung. It undergoes a complex proteolytic maturation, generating multiple processed forms that bind & activate VEGFR-2 & VEGFR-3 receptors. The structure & function of this protein is similar to VEGFC. VEGFD is growth factor which active in angiogenesis, lymphangiogenesis, & endothelial cell growth, stimulating their proliferation & migration & also has effects on the permeability of blood vessels.
Description	Recombinant Mouse Vascular Endothelial Growth Factor D is produced by our Mammalian expression system & the target gene encoding Phe98-Ser206 is expressed with a 6His tag at the C-terminus.
Endotoxin	Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Formulation	Supplied as a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH7.4.
Molecular Weight	13, 1
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Seq Length	Phe98-Ser206
Ship Description	The product is shipped on dry ice/ice packs.
Storage	Store at < -20C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Request delivery time