Comparison

Recombinant Human Thy-1 Membrane Glycoprotein/THY1/CD90

Item no. CH93-50ug
Manufacturer Bon Opus
Amount 50ug
Category
Type Proteins Recombinant
Format Lyophilized
Specific against Human
Host E.coli
Conjugate/Tag None
Purity Greater than 95% as determined by reducing SDS-PAGE.
Sequence QKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSL TRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVL YLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLR DKLVK
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Thy-1 membrane glycoprotein, THY1, CD90
Available
Background
Thy-1 membrane glycoprotein(THY1)is a 141 amino acids protein that contains 1 Ig-like V-type domain. Thy-1 is a 25-37 kDa heavily N-glycosylated, glycophosphatidylinositol (GPI) anchored conserved cell surface protein with a single V-like immunoglobulin domain, originally discovered as a thymocyte antigen. Thy-1 can be used as a marker for a variety of stem cells & for the axonal processes of mature neurons. Structural study of Thy-1 lead to the foundation of the Immunoglobulin superfamily, of which it is the smallest member, & led to some of the initial biochemical description & characterization of a vertebrate GPI anchor & also the first demonstration of tissue specific differential glycosylation. It may play a role in cell-cell or cell-ligand interactions during synaptogenesis & other events in the brain.
Description
Recombinant Human Thymus cell antigen 1 is produced by our E.coli expression system & the target gene encoding Gln20-Lys129 is expressed.
Endotoxin
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Formulation
Lyophilized from a 0.2 um filtered solution of PBS, pH7.4.
Molecular Weight
12, 4
Reconstitution
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Seq Length
Gln20-Lys129
Ship Description
The product is shipped at ambient temperature.
Storage
Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20C for 3 months.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close