Item no. |
CG56-1mg |
Manufacturer |
Bon Opus
|
Amount |
1mg |
Category |
|
Type |
Proteins Recombinant |
Format |
Lyophilized |
Specific against |
Human |
Host |
E.coli |
Conjugate/Tag |
N-GST |
Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
Sequence |
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYER DEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMA IIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYG VSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHK TYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPK LVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATF GGGDHPPKSDLVPRGSMEDLDQSPLVSSSDSPPRP QPA |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Reticulon-4, Neuroendocrine-specific protein, Neuroendocrine-specific protein C homolog, Foocen, Neurite outgrowth inhibitor, RTN-x, NOGO & Reticulon-5. |
Similar products |
RTN4 |
Available |
|
Background |
RTN4 belongs to multiple-pass membrane peotein, which anchored to the membrane of the endoplasmic reticulum through 2 putative transmembrane domains. It acts as a developmental neurite growth regulatory factor with a roles as a negative regulator of axon-axon adhesion & growth. RTN4 regulates neurite fasciculation, branching & extension in the developing nervous system. It involved in down-regulation of growth, stabilization of wring & restriction of plasticity in the adult CNS. It regulates the radial migration of cortical neurons via an RTN4R-Lingo1 containing receptor complex. |
Description |
Recombinant Human Reticulon-4 is produced by our E.coli expression system & the target gene encoding Met1-Val185 is expressed with a GST tag at the N-terminus. |
Endotoxin |
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test. |
Formulation |
Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH7.4. |
Molecular Weight |
45, 5 |
Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Seq Length |
Met1-Val185 |
Ship Description |
The product is shipped at ambient temperature. |
Storage |
Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7C for 2-7 days. Aliquots of reconstituted samples are stable at < -20C for 3 months. |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.