« Back
Home /
Tyrosine-Protein Phosphatase Non-Receptor Type 1/PTPN1

Tyrosine-Protein Phosphatase Non-Receptor Type 1/PTPN1

Item no.	CG06-500ug
Manufacturer	Bon Opus
Amount	500ug
Category	Oncology Neuroscience Neural Lineage Markers Metabolism Diabetes Cholesterol & Lipid Metabolism Regulation of Appetite Molecular Targets for Neuroscience By Cell Type Carcinoma Peptides & Proteins Recombinant Proteins Stem Cell Markers
Type	Proteins
Specific against	Human
Host	E.coli
Sequence	MNHKVHHHHHHMEMEKEFEQIDKSGSWAAIYQDIRHEASD FPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINA SLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVM LNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDI KSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPA SFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLAD TCLLLMDKR
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Similar products	PTPN1
Available
Background	Tyrosine-Protein Phosphatase Non-Receptor Type 1 (PTPN1) is an enzyme containing 1 tyrosine-protein phosphatase domain. PTPN1 belongs to the protein tyrosine phosphatase (PTP) family, member of which catalyze the hydrolysis of the phosphate monoesters specifically on tyrosine residues. PTPs were isolated & identified based on their enzymatic activity & amino acid sequence. PTPN1 can dephosphorylate the phosphotyrosine residues of the activated insulin receptor kinase. It acts as a regulator of endoplasmic reticulum unfolded protein response & regulates the EFNA5-EPHA3 signaling pathway. PTPN1 is implicated in the regulation of cell growth, differentiation, cell responses to cytokines & hormones, & malignancy transformation.
Description	Recombinant Human Tyrosine-Protein Phosphatase Non-Receptor Type 1/PTPN1 is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Thr435) of Human PTPN1 fused with a His tag at the N-terminus.
acc	P18031
formulation	Supplied as a 0.2 uM filtered solution of 25mM Tris, pH 7.5
storage	Store at < -20C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
uName	PTPN1
ushippingType	Dry Ice/Polar Packs

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 500ug

available

Request delivery time