Item no. |
CD38-500ug |
Manufacturer |
Bon Opus
|
Amount |
500ug |
Category |
|
Type |
Proteins Recombinant |
Format |
Lyophilized |
Specific against |
Human |
Host |
Human |
Conjugate/Tag |
C-Fc |
Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
Sequence |
QAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPG TYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQL CRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAW ALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPC KAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQ SDTTCKNPLEPLPPEMSGTMLMVDDIEGRMDEPKS CDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMIS RTP |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Tumor Necrosis Factor Receptor Superfamily Member 3, Lymphotoxin-Beta Receptor, Tumor Necrosis Factor C Receptor, Tumor Necrosis Factor Receptor 2-Related Protein, Tumor Necrosis Factor Receptor Type III, TNF-RIII, TNFR-III, LTBR, D12S370, TNFCR, TNFR3, TNFRSF3 |
Similar products |
LTBR |
Available |
|
Background |
Tumor necrosis factor receptor superfamily member 3, also known as Lymphotoxin-beta receptor, Tumor necrosis factor C receptor, Tumor necrosis factor receptor 2-related protein, Tumor necrosis factor receptor type III, LTBR, TNFCR, TNFR3 & TNFRSF3, is a member of the tumor necrosis factor (TNF) family of receptors. LTBR is a single-pass type I membrane protein & contains four TNFR-Cys repeats. It is expressed on the surface of most cell types, but not on T & B lymphocytes. LTBR & its ligand play a role in the development & organization of lymphoid tissue & transformed cells. Activation of LTBR can trigger apoptosis. In addition, LTBR can lead to the release of the cytokine interleukin 8. |
Description |
Recombinant Human Lymphotoxin beta receptor is produced by our Mammalian expression system & the target gene encoding Gln31-Met227 is expressed with a Fc tag at the C-terminus. |
Endotoxin |
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test. |
Formulation |
Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH7.4. |
Molecular Weight |
48, 8 |
Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Seq Length |
Gln31-Met227 |
Ship Description |
The product is shipped at ambient temperature. |
Storage |
Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7C for 2-7 days. Aliquots of reconstituted samples are stable at < -20C for 3 months. |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.