Comparison

[Novoprotein] Recombinant Human Transforming Growth Factor a/TGFa

Item no. C178-10ug
Manufacturer Bon Opus
Amount 10ug
Category
Type Proteins Recombinant
Format Lyophilized
Specific against Human
Host E.coli
Conjugate/Tag None
Purity Greater than 95% as determined by reducing SDS-PAGE.
Sequence VSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHS GYVGARCEHADLLAV
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Protransforming Growth Factor Alpha, TGF-Alpha, EGF-Like TGF, ETGF, TGF Type 1, TGFA
Similar products tgf-alpha
Available
Background
Transforming Growth Factor alpha (TGF-alpha) belongs to the EGF family of cytokines. It is a mitogenic polypeptide & secreted protein, which is expressed by monocytes, keratinocytes, & various tumor cells. TGFalpha contains two chains, protransforming growth factor alpha & transforming growth factor alpha. It can bind to the EGF receptor that synergistically with TGFbeta to stimulate anchorage-independent cell proliferation & produce a mitogenic response. TGFalpha interacts with the PDZ domains of MAGI3, SDCBP & SNTA1. The interaction with SDCBP is required for the targeting to the cell surface.
Description
Recombinant Human Transforming Growth Factor alpha is produced by our E.coli expression system & the target gene encoding Val41-Val90 is expressed.
Endotoxin
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Formulation
Lyophilized from a 0.2 um filtered solution of 10mM Acetic Acid .
Molecular Weight
5, 55
Reconstitution
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Seq Length
Val41-Val90
Ship Description
The product is shipped at ambient temperature.
Storage
Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20C for 3 months.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close