Item no. |
C178-10ug |
Manufacturer |
Bon Opus
|
Amount |
10ug |
Category |
|
Type |
Proteins Recombinant |
Format |
Lyophilized |
Specific against |
Human |
Host |
E.coli |
Conjugate/Tag |
None |
Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
Sequence |
VSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHS GYVGARCEHADLLAV |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Protransforming Growth Factor Alpha, TGF-Alpha, EGF-Like TGF, ETGF, TGF Type 1, TGFA |
Similar products |
tgf-alpha |
Available |
|
Background |
Transforming Growth Factor alpha (TGF-alpha) belongs to the EGF family of cytokines. It is a mitogenic polypeptide & secreted protein, which is expressed by monocytes, keratinocytes, & various tumor cells. TGFalpha contains two chains, protransforming growth factor alpha & transforming growth factor alpha. It can bind to the EGF receptor that synergistically with TGFbeta to stimulate anchorage-independent cell proliferation & produce a mitogenic response. TGFalpha interacts with the PDZ domains of MAGI3, SDCBP & SNTA1. The interaction with SDCBP is required for the targeting to the cell surface. |
Description |
Recombinant Human Transforming Growth Factor alpha is produced by our E.coli expression system & the target gene encoding Val41-Val90 is expressed. |
Endotoxin |
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test. |
Formulation |
Lyophilized from a 0.2 um filtered solution of 10mM Acetic Acid . |
Molecular Weight |
5, 55 |
Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Seq Length |
Val41-Val90 |
Ship Description |
The product is shipped at ambient temperature. |
Storage |
Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7C for 2-7 days. Aliquots of reconstituted samples are stable at < -20C for 3 months. |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.