« Back
Home /
Adrenocorticotropic Hormone (ACTH) (1-39), rat (TFA)

Adrenocorticotropic Hormone (ACTH) (1-39), rat (TFA)

Item no.	HY-P1477A-1mg
Manufacturer	MedChem Express
Amount	1 mg
Quantity options	10mM*1 mL 1 mg 500 ug 5 mg
Category	Neuroscience Molecular Targets for Neuroscience Inhibitors & Compound Libraries Small Molecules
Type	Inhibitors
Specific against	other
Purity	99.84
Formula	C212H316F3N57O59S
Citations	[1]Lisak RP, et al. Melanocortin receptor agonist ACTH 1-39 protects rat forebrain neurons from apoptotic, excitotoxic and inflammation-related damage. Exp Neurol. 2015 Nov;273:161-7.<br>[2]Schulz C, et al. Endogenous ACTH, not only alpha-melanocyte-stimulating hormone, reduces food intake mediated by hypothalamic mechanisms. Am J Physiol Endocrinol Metab. 2010 Feb;298(2):E237-44.
Smiles	[SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF (TFA salt)]
ECLASS 10.1	32160490
ECLASS 11.0	32160490
UNSPSC	12000000
Alias	ACTH (1-39) (mouse, rat) (TFA)
Available
Product Description	Adrenocorticotropic Hormone (ACTH) (1-39), rat (TFA) is a potent melanocortin 2 (MC2) receptor agonist.
StorageTemperature	-80°C, 2 years; -20°C, 1 year (Powder, sealed storage, away from moisture)
Shipping	Blue Ice
Manufacturers Applications	Metabolism-protein/nucleotide metabolism
MolecularWeight	4582.23 (free acid)
Clinical_Information	No Development Reported
Manufacturers Research Area	Metabolic Disease; Endocrinology
Solubility	DMSO : 100 mg/mL (ultrasonic)\|H2O : 100 mg/mL (ultrasonic)
Manufacturers Target	Melanocortin Receptor
Isoform	MC2R
Pathway	GPCR/G Protein; Neuronal Signaling

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

HY-P1477A-1mg-safety-datasheet.pdf