« Back
Home /
ACTH (1-39) Human

ACTH (1-39) Human

Item no.	06-271-83037-1mg
Manufacturer	GENWAY
Amount	0,5 mg
Type	Peptides
Specific against	Human
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	GWB-481CD1
Similar products	06-271-83037
Available
Genway ID:	GWB-481CD1
Sequence (One Letter Code):	SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Sequence:	{SER} {TYR} {SER} {MET} {GLU} {HIS} {PHE} {ARG} {TRP} {GLY} {LYS} {PRO} {VAL} {GLY} {LYS} {LYS} {ARG} {ARG} {PRO} {VAL} {LYS} {VAL} {TYR} {PRO} {ASN} {GLY} {ALA} {GLU} {ASP} {GLU} {SER} {ALA} {GLU} {ALA} {PHE} {PRO} {LEU} {GLU} {PHE}
Formula:	C207H308N56O58S
Solubility:	Soluble in water (1 mg/ml). clear. colorless. Adrenocorticotropic Hormones (ACTH). ACTH stimulates the adrenal cortex and the secretion of glucocorticoids such as cortisol. Another name for ACTH is Corticotropin. N/AN/A [1] . JOURNAL Patent: DE 3731875-A 30-MAR-1989; et al.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 0,5 mg

available

Delivery expected until 9/13/2024

Express Delivery: Save 7 days

Compare

Add to wishlist

Recommend by mail