« Back
Home /
Lymphotactin/XCL1, Human

Lymphotactin/XCL1, Human

Item no.	Z02827-1
Manufacturer	GenScript
Amount	1mg(2x500ug)
Category	Oncology Peptides & Proteins Recombinant Proteins Cell Biology Cell Movement Cell Migration & Invasion By Organ Lung Cancer Colorectal Cancer
Type	Proteins
Format	Sterile Filtered White lyophilized (freeze-dried) powder.
Specific against	Human
Purity	>97% by SDS-PAGE and HPLC analyses.
Sequence	GSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	protein/Z02827-Lymphotactin_XCL1_Human, Lymphotactin is the only known member of the C-chemokine family and signals through the receptor XCR1, formally known as GPR5. The spleen shows the highest level of lymphotactin compared to peripheral leukocytes, lung, colon and small intestine. Lymphotactin is chemotactic towards lymphocytes but not towards monocytes or neutrophils.</td></tr><tr><th>M.W.</th><td colspan="7"> 10.0 kDa, a single non-glycosylated polypeptide chain containing 92 amino acids.</td></tr><tr><th>Purity</th><td colspan="7"> >97% by SDS-PAGE and HPLC analyses.</td></tr><tr><th>Endotoxin Level</th><td colspan="7"> Less than 0.2EU/ug of rHuCXCL13 as determined by LAL method.</td></tr><tr><th>Specific Activity</th><td colspan="7"> Fully biologically active when compared to standard. The ED50 determined by a chemotaxis bioassay using human T-lymphocytes is less than 100 ng/ml, corresponding to a specific activity of &
Similar products	Lymphotactin/XCL1
Available
Specificity	Fully biologically active when compared to standard. The ED50 determined by a chemotaxis bioassay using human T-lymphocytes is less than 100 ng/ml, corresponding to a specific activity of ＞, 1.0 x 104 IU/mg.
Specificity	Fully biologically active when compared to standard. The ED50 determined by a chemotaxis bioassay using human T-lymphocytes is less than 100 ng/ml, corresponding to a specific activity of ＞, 1.0 x 104 IU/mg.
Description	Lymphotactin is the only known member of the C-chemokine family and signals through the receptor XCR1, formally known as GPR5. The spleen shows the highest level of lymphotactin compared to peripheral leukocytes, lung, colon and small intestine. Lymphotactin is chemotactic towards lymphocytes but not towards monocytes or neutrophils.
Endotoxin Level	Less than 0.2EU/ug of rHuCXCL13 as determined by LAL method.
Formulation	Lyophilized from a 0.2µ, m filtered concentrated, solution in 20mM PB, pH7.4, 150mM NaCl.
M.W.	10.0 kDa, a single non-glycosylated polypeptide chain containing 92 amino acids.
Product Line	Cytokine, Chemokines & Growth Factors
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 °, C. Further dilutions should be made in appropriate buffered solutions.
Storage	This lyophilized preparation is stable at 2-8 C, but should be kept at -20 C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 C to -70 C. Avoid repeated freeze/thaw cycles.
Usage	This material is for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE.
Product Origin	USA

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Z02827-1-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg(2x500ug)

available

Delivery expected until 9/6/2024

Express Delivery: Save 3 days

Compare

Add to wishlist

Recommend by mail