Item no. |
Z02735-10 |
Manufacturer |
GenScript
|
Amount |
10ug |
Category |
|
Type |
Proteins |
Format |
Sterile Filtered White lyophilized (freeze-dried) powder. |
Specific against |
Human |
Purity |
>96% by SDS-PAGE and HPLC analyses. |
Sequence |
MCNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQK GIPVRGKKTK KEQKTAHFLP MAIT |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
protein/Z02735-Keratinocye_Growth_Factor-1_KGF-1_Human, Keratinocyte Growth Factor-1 (KGF-1/FGF-7) is one of 23 known members of the FGF family. All FGFs have two conserved cysteine residues and share 30 - 50% sequence identity at the amino acid level. Proteins of this family play a central role during prenatal development and postnatal growth and regeneration of variety of tissues, by promoting cellular proliferation and differentiation. KGF-1/FG-7 is a mitogen factor specific for epithelial cells and keratinocytes and signals through FGFR 2b. KGF-1/FGF-7 plays a role in kidney and lung development, angiogenesis, and wound healing.</td></tr><tr><th>M.W.</th><td colspan="7"> Approximately 19.0 kDa, a single, non-glycosylated polypeptide chain containing 164 amino acids.</td></tr><tr><th>Purity</th><td colspan="7"> >96% by SDS-PAGE and HPLC analyses.</td></tr><tr><th>Endotoxin Level</th><td colspan="7"> Less than 1 EU/ug of rHuFGF-7/KGF-1 as determined by LAL method.</td></tr><tr><th>Specific Activity</th><td colspan="7"> Fully biologically active when compared to standard. The ED50 determined by a cell proliferation assay using monkey 4MBr-5 cells is less than 75 ng/ml, corresponding to a specific activity of & |
Similar products |
Fibroblast |
Available |
|
Specificity |
Fully biologically active when compared to standard. The ED50 determined by a cell proliferation assay using monkey 4MBr-5 cells is less than 75 ng/ml, corresponding to a specific activity of >, 1.3 x 104 IU/mg. |
Specificity |
Fully biologically active when compared to standard. The ED50 determined by a cell proliferation assay using monkey 4MBr-5 cells is less than 75 ng/ml, corresponding to a specific activity of >, 1.3 x 104 IU/mg. |
Description |
Keratinocyte Growth Factor-1 (KGF-1/FGF-7) is one of 23 known members of the FGF family. All FGFs have two conserved cysteine residues and share 30 - 50% sequence identity at the amino acid level. Proteins of this family play a central role during prenatal development and postnatal growth and regeneration of variety of tissues, by promoting cellular proliferation and differentiation. KGF-1/FG-7 is a mitogen factor specific for epithelial cells and keratinocytes and signals through FGFR 2b. KGF-1/FGF-7 plays a role in kidney and lung development, angiogenesis, and wound healing. |
Endotoxin Level |
Less than 1 EU/ug of rHuFGF-7/KGF-1 as determined by LAL method. |
Formulation |
Lyophilized from a 0.2um filtered solution in 20mM PB, pH 8.0, 1M NaCl. |
M.W. |
Approximately 19.0 kDa, a single, non-glycosylated polypeptide chain containing 164 amino acids. |
Product Line |
Cytokine, Chemokines & Growth Factors |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 C. Further dilutions should be made in appropriate buffered solutions. |
Storage |
This lyophilized preparation is stable at 2-8 C, but should be kept at -20C to -80C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 C to -70 C. Avoid repeated freeze/thaw cycles. |
Usage |
This material is for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. |
Product Origin |
USA |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.