« Back
Home /
Apelin-36, bovine

Apelin-36, bovine

Item no.	RP13713
Manufacturer	GenScript
Amount	0.1mg
Category	Oncology Neuroscience Metabolism Glucose Homeostasis Molecular Targets for Neuroscience By Cell Type Hematology Lymphoma Peptides & Proteins Obesity Peptides
Type	Peptides
Specific against	Cattle
Purity	> 95%
Sequence	LVQPRGPRSGPGPWQGGRRKFRRQRPRLSHKGPMPF ; {LEU}{VAL}{GLN}{PRO}{ARG}{GLY}{PRO}{ARG}{SER}{GLY}{PRO}{GLY}{PRO}{TRP}{GLN}{GLY}{GLY}{ARG}{ARG}{LYS}{PHE}{ARG}{ARG}{GLN}{ARG}{PRO}{ARG}{LEU}{SER}{HIS}{LYS}{GLY}{PRO}{MET}{PRO}{PHE}
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP13713-Apelin-36_Bovine, Apelin, a recently isolated neuropeptide that is expressed in the supraoptic and the paraventricular nuclei, acts on specific receptors located on vasopressinergic neurons. Apelin-36 belongs to the apelin family. Apelin is the natural ligand of the orphan receptor APJ and is abundantly secreted in the colostrum. Apelin-36 has a greater inhibitory activity on HIV infection than other synthetic apelin derivatives. </td></tr><tr><th>Solubility</th><td colspan="7"> Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store at -20C. Keep tightly closed. Store in a cool dry place. </td></tr>
Similar products	Apelin-36
Available
Description	Apelin, a recently isolated neuropeptide that is expressed in the supraoptic and the paraventricular nuclei, acts on specific receptors located on vasopressinergic neurons. Apelin-36 belongs to the apelin family. Apelin is the natural ligand of the orphan receptor APJ and is abundantly secreted in the colostrum. Apelin-36 has a greater inhibitory activity on HIV infection than other synthetic apelin derivatives.
Solubility	Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
Storage	Store at -20C. Keep tightly closed. Store in a cool dry place.
Product Origin	USA

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 0.1mg

available

Delivery expected until 9/27/2024

Express Delivery: Save 1 days

Compare

Add to wishlist

Recommend by mail