Item no. |
CSB-YP897497HU-50 |
Manufacturer |
Cusabio
|
Amount |
50ug |
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
Yeast |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 5.1 |
34160400 |
ECLASS 6.1 |
34160400 |
ECLASS 8.0 |
42020190 |
ECLASS 9.0 |
42020190 |
ECLASS 10.0.1 |
32160409 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
RIP-like protein kinase 3,Receptor-interacting protein 3,Short name:,RIP-3 |
Available |
|
Research Topic |
Cell Biology |
Uniprot ID |
Q9Y572 |
Gene Names |
RIPK3 |
Organism |
Homo sapiens (Human) |
AA Sequence |
MSCVKLWPSGAPAPLVSIEELENQELVGKGGFGTV FRAQHRKWGYDVAVKIVNSKAISREVKAMASLDNE FVLRLEGVIEKVNWDQDPKPALVTKFMENGSLSGL LQSQCPRPWPLLCRLLKEVVLGMFYLHDQNPVLLH RDLKPSNVLLDPELHVKLADFGLSTFQGGSQSGTG SGEPGGTLGYLAPELFVNVNRKASTASDVYSFGIL MWAVLAGREVELPTEPSLVYEAVCNRQNRPSLAEL PQAGPETPGLEGLKELMQLCWSSEPKDRPSFQECL PKTDEVFQMVENNMNAAVSTVKDFLSQLRSSNRRF SIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLN KLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTA GTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPG PRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNC SGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQH PPPVGSQEGPKDPEAWSRPQGWYNHSGK |
Expression Region |
1-518aa |
Sequence Info |
Full Length |
Source |
Yeast |
Tag Info |
N-terminal 6xHis-tagged |
MW |
58.9 kDa |
Alternative Name(s) |
RIP-like protein kinase 3 Receptor-interacting protein 3 Short name: RIP-3 |
Relevance |
Essential for necroptosis, a programmed cell death process in response to death-inducing TNF-alpha family members. Upon induction of necrosis, RIPK3 interacts with, and phosphorylates RIPK1 and MLKL to form a necrosis-inducing complex. RIPK3 binds to and enhances the activity of three metabolic enzymes: GLUL, GLUD1, and PYGL. These metabolic enzymes may eventually stimulate the tricarboxylic acid cycle and oxidative phosphorylation, which could result in enhanced ROS production. |
Reference |
"Identification of RIP3, a RIP-like kinase that activates apoptosis and NFkappaB."Yu P.W., Huang B.C.B., Shen M., Quast J., Chan E., Xu X., Nolan G.P., Payan D.G., Luo Y.Curr. Biol. 9:539-542(1999) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Essential for necroptosis, a programmed cell death process in response to death-inducing TNF-alpha family members. Upon induction of necrosis, RIPK3 interacts with, and phosphorylates RIPK1 and MLKL to form a necrosis-inducing complex. RIPK3 binds to and enhances the activity of three metabolic enzymes |
Subcellular Location |
Cytoplasm, cytosol, Cell membrane, Mitochondrion |
Protein Families |
Protein kinase superfamily, TKL Ser/Thr protein kinase family |
Tissue Specificity |
Highly expressed in the pancreas. Detected at lower levels in heart, placenta, lung and kidney. Isoform 3 is significantly increased in colon and lung cancers. |
Paythway |
TNFsignalingpathway |
Tag Information |
N-terminal 6xHis-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.