Item no. |
CSB-YP891951HU-10 |
Manufacturer |
Cusabio
|
Amount |
10ug |
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
Yeast |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
COMPase |
Available |
|
Research Topic |
Cell Biology |
Uniprot ID |
Q9UKP4 |
Gene Names |
ADAMTS7 |
Organism |
Homo sapiens (Human) |
AA Sequence |
KWVETLVVADAKMVEYHGQPQVESYVLTIMNMVAG LFHDPSIGNPIHITIVRLVLLEDEEEDLKITHHAD NTLKSFCKWQKSINMKGDAHPLHHDTAILLTRKDL CAAMNRPCETLGLSHVAGMCQPHRSCSINEDTGLP LAFTVAHELGHSFGIQHDGSGNDCEPVGKRPFIMS PQLLYDAAPLTWSRCSRQYITRFLDRGWGLCLDDP PAKDIIDFPSVPPGVLYDVSHQCRLQYGAYSAFCE DMDNVCHTLWCSVGTTCHSKLDAAVDGTRCGENKW CLSGECVPVGFRPEAVDGGWSGWSAWSICSRSCGM GVQSAERQCTQPTPKYKGRYCVGERKRFRLCNLQA CP |
Expression Region |
242-593aa |
Sequence Info |
Partial |
Source |
Yeast |
Tag Info |
N-terminal 6xHis-tagged |
MW |
41.1 kDa |
Alternative Name(s) |
COMPase |
Relevance |
Metalloprotease that may play a role in the degradation of COMP. |
Reference |
"ADAMTS-7: a metalloproteinase that directly binds to and degrades cartilage oligomeric matrix protein."Liu C.-J., Kong W., Ilalov K., Yu S., Xu K., Prazak L., Fajardo M., Sehgal B., Di Cesare P.E.FASEB J. 20:988-990(2006) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Metalloprotease that may play a role in the degradation of COMP. |
Subcellular Location |
Secreted, extracellular space, extracellular matrix |
Tissue Specificity |
Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Detected in meniscus, bone, tendon, cartilage, synovium, fat and ligaments. |
Tag Information |
N-terminal 6xHis-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.