« Back
Home /
Recombinant Human Group XIIA secretory phospholipase A2(PLA2G12A),partial

Recombinant Human Group XIIA secretory phospholipase A2(PLA2G12A),partial

Item no.	CSB-YP863638HU-10
Manufacturer	Cusabio
Amount	10ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Phosphatidylcholine 2-acylhydrolase 12A
Available
Research Topic	Metabolism
Uniprot ID	Q9BZM1
Gene Names	PLA2G12A
Organism	Homo sapiens (Human)
AA Sequence	QEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLLG GEDGLCQYKCSDGSKPFPRYGYKPSPPNGCGSPLF GVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEE FQYCLSKICRDVQKTLGLTQHVQACETTVELLFDS VIHLGCKPYLDSQRAACRCHYEE
Expression Region	23-185aa
Sequence Info	Partial
Source	Yeast
Tag Info	N-terminal 6xHis-tagged
MW	20.3 kDa
Alternative Name(s)	Phosphatidylcholine 2-acylhydrolase 12A
Relevance	PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. Does not exhibit detectable activity toward sn-2-arachidonoyl- or linoleoyl-phosphatidylcholine or -phosphatidylethanolamine.
Reference	Cloning and recombinant expression of a structurally novel human secreted phospholipase A2.Gelb M.H., Valentin E., Ghomashchi F., Lazdunski M., Lambeau G.J. Biol. Chem. 275:39823-39826(2000)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. Does not exhibit detectable activity toward sn-2-arachidonoyl- or linoleoyl-phosphatidylcholine or -phosphatidylethanolamine.
Subcellular Location	Secreted, Cytoplasm
Protein Families	Phospholipase A2 family
Tissue Specificity	Abundantly expressed in heart, skeletal muscle, kidney, liver and pancreas.
Paythway	Vascularsmoothmusclecontraction
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-YP863638HU-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time