« Back
Home /
Recombinant Human Receptor-type tyrosine-protein phosphatase N2(PTPRN2),partial

Recombinant Human Receptor-type tyrosine-protein phosphatase N2(PTPRN2),partial

Item no.	CSB-YP852923HU-10
Manufacturer	Cusabio
Amount	10ug
Category	Metabolism Diabetes Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Islet cell autoantigen-related protein ;IAR ;ICAARPhogrin
Available
Research Topic	Immunology
Uniprot ID	Q92932
Gene Names	PTPRN2
Organism	Homo sapiens (Human)
AA Sequence	AAPSSVPRGRQLPGRLGCLLEEGLCGASEACVNDG VFGRCQKVPAMDFYRYEVSPVALQRLRVALQKLSG TGFTWQDDYTQYVMDQELADLPKTYLRRPEASSPA RPSKHSVGSERRYSREGGAALANALRRHLPFLEAL SQAPASDVLARTHTAQDRPPAEGDDRFSESILTYV AHTSALTYPPGSRTQLREDLLPRTLGQLQPDELSP KVDSGVDRHHLMAALSAYAAQRPPAPPGEGSLEPQ YLLRAPSRMPRPLLAPAAPQKWPSPLGDSEDPSST GDGARIHTLLKDLQRQPAEVRGLSGLELDGMAELM AGLMQGVDHGVARGSPGRAALGESGEQADGPKATL RGDSFPDDGVQDDDDRLYQEVHRLSATLGGLLQDH GSRLLPGALPFARPLDMERKKSEHPESSLSSEEET AGVENVKSQTYSKDLLGQQPHSEPGAAAFGELQNQ MPGPSKEEQSLPAGAQEALSDGLQLEVQPSEEEAR GYIVTDRDPLRPEEGRRLVEDVARLLQVPSSAFAD VEVLGPAVTFKVSANVQNVTTEDVEKATVDNKDKL EETSGLKILQTGVGSKSKLKFLPPQAEQEDSTKF
Expression Region	22-615aa
Sequence Info	Extracellular Domain
Source	Yeast
Tag Info	N-terminal 6xHis-tagged
MW	66.1 kDa
Alternative Name(s)	Islet cell autoantigen-related protein ; IAR ; ICAARPhogrin
Relevance	Implicated in development of nervous syst and pancreatic endocrine cells.
Reference	The DNA sequence of human chromosome 7.Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L. , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.Nature 424:157-164(2003)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Plays a role in vesicle-mediated secretory processes. Required for normal accumulation of secretory vesicles in hippocampus, pituitary and pancreatic islets. Required for the accumulation of normal levels of insulin-containing vesicles and preventing their degradation. Plays a role in insulin secretion in response to glucose stimuli. Required for normal accumulation of the neurotransmitters norepinephrine, dopamine and serotonin in the brain. In females, but not in males, required for normal accumulation and secretion of pituitary hormones, such as luteinizing hormone (LH) and follicle-stimulating hormone (FSH) (By similarity). Required to maintain normal levels of renin expression and renin release (By similarity). May regulate catalytic active protein-tyrosine phosphatases such as PTPRA through dimerization (By similarity). Has phosphatidylinositol phosphatase activity; the PIPase activity is involved in its ability to regulate insulin secretion. Can dephosphorylate phosphatidylinositol 4, 5-biphosphate (PI(4, 5)P2), phosphatidylinositol 5-phosphate and phosphatidylinositol 3-phosphate (By similarity). Regulates PI(4, 5)P2 level in the plasma membrane and localization of cofilin at the plasma membrane and thus is indirectly involved in regulation of actin dynamics related to cell migration and metastasis; upon hydrolyzation of PI(4, 5)P2 cofilin is released from the plasma membrane and acts in the cytoplasm in severing F-actin filaments
Involvement in disease	Autoantigen in insulin-dependent diabetes mellitus (IDDM).
Subcellular Location	Cytoplasmic vesicle, secretory vesicle membrane, Single-pass type I membrane protein, Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane, Single-pass type I membrane protein
Protein Families	Protein-tyrosine phosphatase family, Receptor class 8 subfamily
Tissue Specificity	Highest levels in brain and pancreas (PubMed:8954911, PubMed:8798755). Lower levels in trachea, prostate, stomach and spinal chord (PubMed:8798755).
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time