« Back
Home /
Recombinant Mouse Dedicator of cytokinesis protein 8(Dock8),partial

Recombinant Mouse Dedicator of cytokinesis protein 8(Dock8),partial

Item no.	CSB-YP807451MO1-1
Manufacturer	Cusabio
Amount	1mg
Quantity options	1mg 10ug 100ug 20ug 200ug 50ug 500ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Purity	Greater than 85% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research areas	others
Target / Protein	Dock8
Biologically active	Not Test
Expression system	Yeast
Species of origin	Mus musculus (Mouse)
Uniprot ID	Q8C147
AA Sequence	RNLLYVYPQRLNFASKLASARNITIKIQFMCGEDP SNAMPVIFGKSSGPEFLQEVYTAITYHNKSPDFYE EVKIKLPAKLTVNHHLLFTFYHISCQQKQGASGES LLGYSWLPILLNERLQTGSYCLPVALEKLPPNYSI HSAEKVPLQNPPIKWAEGHKGVFNIEVQAV
Tag Info	N-terminal 6xHis-tagged
Expression Region	561-730aa
Protein length	Partial
MW	21.2 kDa
Relevance	Potential guanine nucleotide exchange factor (GEF). GEF proteins activate some small GTPases by exchanging bound GDP for free GTP. Is involved in NK cell cytotoxicity controlling polarization of microtubule-organizing center (MTOC), and possibly regulating CCDC88B-mediated lytic granule transport to MTOC during cell killing
References	"Prediction of the coding sequences of mouse homologues of FLJ genes: the complete nucleotide sequences of 110 mouse FLJ-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries." Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S., Saga Y., Kitamura H., Nakagawa T., Nagase T., Ohara O., Koga H. DNA Res. 11:127-135(2004)
Purity	Greater than 85% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Guanine nucleotide exchange factor (GEF) which specifically activates small GTPase CDC42 by exchanging bound GDP for free GTP
Subcellular Location	Cytoplasm, Cell membrane, Peripheral membrane protein, Cytoplasmic side, Cell projection, lamellipodium membrane, Peripheral membrane protein, Cytoplasmic side
Protein Families	DOCK family
Tissue Specificity	Expressed in T cells (PubMed:28028151). Expressed in bone marrow-derived dendritic cells (PubMed:25713392).
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Request delivery time